KEGG   Homo sapiens (human): 10607Help
Entry
10607             CDS       T01001                                 

Gene name
TBL3, SAZD, UTP13
Definition
(RefSeq) transducin beta like 3
  KO
K14555  
U3 small nucleolar RNA-associated protein 13
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    10607 (TBL3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    10607 (TBL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q12788(Tdark)
UniProt: 
Position
16p13.3
AA seq 808 aa AA seqDB search
MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNILEVASGAVLRS
LEQEDQEDITAFDLSPDNEVLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVATMAFDPT
STLLATGGCDGAVRVWDIVRHYGTHHFRGSPGVVHLVAFHPDPTRLLLFSSATDAAIRVW
SLQDRSCLAVLTAHYSAVTSLAFSADGHTMLSSGRDKICIIWDLQSCQATRTVPVFESVE
AAVLLPEEPVSQLGVKSPGLYFLTAGDQGTLRVWEAASGQCVYTQAQPPGPGQELTHCTL
AHTAGVVLTATADHNLLLYEARSLRLQKQFAGYSEEVLDVRFLGPEDSHVVVASNSPCLK
VFELQTSACQILHGHTDIVLALDVFRKGWLFASCAKDQSVRIWRMNKAGQVMCVAQGSGH
THSVGTVCCSRLKESFLVTGSQDCTVKLWPLPKALLSKNTAPDNGPILLQAQTTQRCHDK
DINSVAIAPNDKLLATGSQDRTAKLWALPQCQLLGVFSGHRRGLWCVQFSPMDQVLATAS
ADGTIKLWALQDFSCLKTFEGHDASVLKVAFVSRGTQLLSSGSDGLVKLWTIKNNECVRT
LDAHEDKVWGLHCSRLDDHALTGASDSRVILWKDVTEAEQAEEQARQEEQVVRQQELDNL
LHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVT
WNTNSRHCHEAQAVLGVLLRREAPEELLAYEGVRAALEALLPYTERHFQRLSRTLQAAAF
LDFLWHNMKLPVPAAAPTPWETHKGALP
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaccgcggccggagtgggccgcttcaagaccaactatgctgtggagcgcaaa
attgagcctttctacaagggcggaaaagcacagctggaccagactggccagcacctcttc
tgcgtctgtggcaccagagtcaacattctggaagtggcctcgggggccgtgctgcggagt
ctggagcaggaggaccaggaggacatcactgcctttgacctcagccctgacaacgaggtg
ctggtgacagccagtcgggcattgctgctggctcagtgggcctggcaagagggcagcgtt
acccgcctgtggaaggcgatacacacggcccccgtggccaccatggccttcgaccccacc
tccactctgctagccacaggtggctgtgatggggccgtgcgcgtctgggacatcgtgcgg
cactacgggacacaccacttccgaggctcgcccggtgtcgtgcacctagtggccttccac
ccggaccctacacgcctgctgctcttctcctcggccacggatgccgccatccgcgtgtgg
tcactgcaggaccggtcatgcctggctgtgctgactgcccactacagcgccgtcacctca
ctggccttcagcgccgacggccacaccatgctcagctccggccgtgacaagatatgtatc
atctgggaccttcagagctgccaggccacgaggaccgtgcctgtgtttgagagcgtggag
gctgctgtgctgttgccagaggagccagtgtcccagctgggtgtgaagtccccagggctg
tactttctgacagctggcgaccaaggcactctgcgcgtgtgggaggcagcttctgggcag
tgtgtgtacacgcaggcccagccgccgggccctgggcaggagctgacccactgcaccctg
gcacacaccgccggcgtggtcctcaccgccaccgccgaccacaacctgttgctctacgag
gctcgctccctgcggctgcagaaacagttcgctggctacagtgaggaggttttggatgtc
cggtttcttgggcccgaggactcccacgttgtcgtggcctccaatagcccctgcctaaaa
gtgtttgagctgcagacgtcagcctgccagatcctccacggccacacggatatcgtcctg
gccctggatgtgttccggaaggggtggctctttgccagctgtgccaaggatcagagcgtc
cgtatctggagaatgaacaaggctggccaggtgatgtgcgtggctcagggttccggtcac
acacacagtgtgggcaccgtctgctgctctaggctgaaggagtccttcctggtgacaggc
agccaggactgcactgtgaagctgtggcctcttcccaaagccttgctgtccaagaacaca
gccccagacaacggccctatcctcctgcaggcccagaccactcagcgctgccatgataag
gacatcaacagcgtggctattgcccccaacgacaagctgctggccacaggctcacaggac
cgcacggccaagctctgggccctgccacagtgccagctgctgggtgtcttctcaggccac
cggcgtggcctctggtgcgtccagttctctcccatggaccaggtgctggccacggcctca
gctgatggcaccatcaagctctgggcactccaggacttcagctgtctcaagacatttgag
gggcacgatgcttctgtgctgaaggtggcctttgtgagccgtggcacgcagctgctgtcc
agcggttcggatggcctcgtgaagctctggaccatcaagaacaacgagtgtgtgcggacg
ctggatgcccacgaggacaaggtctgggggctgcactgcagccggctggacgaccacgcc
ctcactggggccagtgactcccgagtcatcctctggaaggatgtgaccgaggcggagcag
gcagaggagcaggccaggcaagaggagcaggtggtcaggcagcaagagctggacaacctg
ctgcatgagaagcggtacctgcgggcgctgggcctggccatctccctggatcggccccac
accgtgctgactgtcatccaggccatccggagggaccctgaggcctgcgagaagctggaa
gccaccatgctccgactgcggcgcgaccagaaagaggccctgctgcgcttctgcgtcacg
tggaacaccaactcgcggcactgccacgaggcccaggccgtgctgggtgtgctcttgagg
cgagaggcccccgaggagctgctggcctacgaaggcgtgcgggcagcgcttgaggccctg
ctgccctacactgagcggcactttcagcggctcagcaggaccctccaggccgccgctttc
ttggacttcctgtggcacaacatgaagctccctgtgccggccgccgcccccaccccctgg
gaaacccataaaggcgcactgccctag

DBGET integrated database retrieval system