KEGG   Homo sapiens (human): 10627Help
Entry
10627             CDS       T01001                                 

Gene name
MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B
Definition
(RefSeq) myosin light chain 12A
  KO
K12757  
myosin regulatory light chain 12
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Tight junction
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10627 (MYL12A)
  Cellular commiunity
   04510 Focal adhesion
    10627 (MYL12A)
   04530 Tight junction
    10627 (MYL12A)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10627 (MYL12A)
   04670 Leukocyte transendothelial migration
    10627 (MYL12A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     10627 (MYL12A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   10627 (MYL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.31
AA seq 171 aa AA seqDB search
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat
gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt
gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg
gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc
aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat
gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat
tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag
ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc
atcctgaaacatggagccaaagacaaagatgactga

DBGET integrated database retrieval system