KEGG   Homo sapiens (human): 10629Help
Entry
10629             CDS       T01001                                 

Gene name
TAF6L, PAF65A
Definition
TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Orthology
K03131  
transcription initiation factor TFIID subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    10629 (TAF6L)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    10629 (TAF6L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     10629 (TAF6L)
   Coactivators
    SAGA/TFTC/STAGA complex
     10629 (TAF6L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 622 aa AA seqDB search
MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKR
RKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPK
GCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVAL
QDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVG
SVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADP
VRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYG
AILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLP
LPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPD
SVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPG
TGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPM
IGRTSRPARRWALSDYSLYLPL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgagaagagcggcggtttgtggagatccctcgggagtctgtccggctcatg
gcggagagcacgggcctggagctgagcgatgaggtggcggcgctgctcgcagaggacgtg
tgctatcgtctgagagaggccacgcagaatagctctcagttcatgaagcacaccaaacgc
cggaagctgacggttgaggacttcaacagggccctcagatggagcagcgtggaggctgtg
tgtggttacggatcacaggaggcactgcccatgcgccccgccagggagggtgaactctac
tttcctgaggatcgagaggtgaacctggtggagctggccctggctaccaacatccccaaa
ggctgtgctgagacagctgtcagagttcatgtctcctacctggatggcaaagggaacctg
gcacctcaaggatcggtgcccagtgctgtgtcttcactgacagatgaccttctcaagtac
tatcaccaggtgactcgtgctgtgctaggggatgatccgcaactgatgaaggttgcactc
caggacttgcagacgaactccaagattggggcactcctgccttactttgtttatgtggtc
agtggggtgaaatctgtaagccatgacctggagcaactgcaccggctgctgcaggtggca
cggagcctatttcgtaatccgcacctgtgcttggggccctatgtccgctgtctggtgggc
agtgtcctctactgtgtcctggagccactggctgcctccatcaaccccctgaatgaccac
tggactctgcgggatggggctgccctcctgctcagccacatcttctggactcatggggac
cttgtaagtggcctctatcagcatatcctgctatccctgcagaagatcctggcagatcct
gtgcggccgctctgctgccactatggagccgtggtggggctgcatgctcttggctggaag
gcagtagaacgagtcctgtacccacacctgtccacctactggacaaacttgcaggctgtg
ctggatgattattcagtatctaatgcccaggtcaaagcagatggacacaaagtctatgga
gccattctggtggcggtagagcgactgctgaagatgaaggcccaggcagcagagcccaac
aggggtggcccaggtggcagggggtgccggcgcctggacgacctgccatgggacagcctt
ctctttcaagagtcgtcctccgggggcggtgcagaacccagctttgggtccggcctcccg
ctgccgccagggggcgcggggccggaggacccttctctttcggtgaccctggccgacatc
taccgggagctctacgccttcttcggtgacagcttggccacacgctttggcaccggccag
cctgcacccacggctccgcggccgcccggggacaagaaggagccggcggcagccccggac
tcggtgcggaagatgccgcagctgacggcaagcgccatagtcagcccgcacggcgacgag
agcccccggggcagcggcggaggcggccccgcgtcggcctctgggcccgccgcctctgag
agcaggcccttgccgcgcgtgcatcgggcgcgcggggcaccccggcagcagggccccggg
accggcacccgcgacgttttccagaagagccgtttcgccccgcgcggcgccccgcacttt
cgtttcatcatagccgggcggcaggctgggaggcgctgccgcgggcgccttttccagact
gccttccccgcgccgtacgggcctagcccggcctcgcgctacgtgcagaaactgcccatg
atcggccgtaccagccgccccgcccgccggtgggcgctctcggactactcgctgtacttg
ccgctctga

DBGET integrated database retrieval system