KEGG   Homo sapiens (human): 10629Help
Entry
10629             CDS       T01001                                 

Gene name
TAF6L, PAF65A
Definition
(RefSeq) TATA-box binding protein associated factor 6 like
  KO
K03131  
transcription initiation factor TFIID subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    10629 (TAF6L)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    10629 (TAF6L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     10629 (TAF6L)
   Coactivators
    SAGA/TFTC/STAGA complex
     10629 (TAF6L)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     10629 (TAF6L)
    STAGA complex
     10629 (TAF6L)
    TFTC complex
     10629 (TAF6L)
    SAGA complex
     10629 (TAF6L)
    SLIK complex
     10629 (TAF6L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12.3
AA seq 622 aa AA seqDB search
MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQNSSQFMKHTKR
RKLTVEDFNRALRWSSVEAVCGYGSQEALPMRPAREGELYFPEDREVNLVELALATNIPK
GCAETAVRVHVSYLDGKGNLAPQGSVPSAVSSLTDDLLKYYHQVTRAVLGDDPQLMKVAL
QDLQTNSKIGALLPYFVYVVSGVKSVSHDLEQLHRLLQVARSLFRNPHLCLGPYVRCLVG
SVLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQHILLSLQKILADP
VRPLCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYG
AILVAVERLLKMKAQAAEPNRGGPGGRGCRRLDDLPWDSLLFQESSSGGGAEPSFGSGLP
LPPGGAGPEDPSLSVTLADIYRELYAFFGDSLATRFGTGQPAPTAPRPPGDKKEPAAAPD
SVRKMPQLTASAIVSPHGDESPRGSGGGGPASASGPAASESRPLPRVHRARGAPRQQGPG
TGTRDVFQKSRFAPRGAPHFRFIIAGRQAGRRCRGRLFQTAFPAPYGPSPASRYVQKLPM
IGRTSRPARRWALSDYSLYLPL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgagaagagcggcggtttgtggagatccctcgggagtctgtccggctcatg
gcggagagcacgggcctggagctgagcgatgaggtggcggcgctgctcgcagaggacgtg
tgctatcgtctgagagaggccacgcagaatagctctcagttcatgaagcacaccaaacgc
cggaagctgacggttgaggacttcaacagggccctcagatggagcagcgtggaggctgtg
tgtggttacggatcacaggaggcactgcccatgcgccccgccagggagggtgaactctac
tttcctgaggatcgagaggtgaacctggtggagctggccctggctaccaacatccccaaa
ggctgtgctgagacagctgtcagagttcatgtctcctacctggatggcaaagggaacctg
gcacctcaaggatcggtgcccagtgctgtgtcttcactgacagatgaccttctcaagtac
tatcaccaggtgactcgtgctgtgctaggggatgatccgcaactgatgaaggttgcactc
caggacttgcagacgaactccaagattggggcactcctgccttactttgtttatgtggtc
agtggggtgaaatctgtaagccatgacctggagcaactgcaccggctgctgcaggtggca
cggagcctatttcgtaatccgcacctgtgcttggggccctatgtccgctgtctggtgggc
agtgtcctctactgtgtcctggagccactggctgcctccatcaaccccctgaatgaccac
tggactctgcgggatggggctgccctcctgctcagccacatcttctggactcatggggac
cttgtaagtggcctctatcagcatatcctgctatccctgcagaagatcctggcagatcct
gtgcggccgctctgctgccactatggagccgtggtggggctgcatgctcttggctggaag
gcagtagaacgagtcctgtacccacacctgtccacctactggacaaacttgcaggctgtg
ctggatgattattcagtatctaatgcccaggtcaaagcagatggacacaaagtctatgga
gccattctggtggcggtagagcgactgctgaagatgaaggcccaggcagcagagcccaac
aggggtggcccaggtggcagggggtgccggcgcctggacgacctgccatgggacagcctt
ctctttcaagagtcgtcctccgggggcggtgcagaacccagctttgggtccggcctcccg
ctgccgccagggggcgcggggccggaggacccttctctttcggtgaccctggccgacatc
taccgggagctctacgccttcttcggtgacagcttggccacacgctttggcaccggccag
cctgcacccacggctccgcggccgcccggggacaagaaggagccggcggcagccccggac
tcggtgcggaagatgccgcagctgacggcaagcgccatagtcagcccgcacggcgacgag
agcccccggggcagcggcggaggcggccccgcgtcggcctctgggcccgccgcctctgag
agcaggcccttgccgcgcgtgcatcgggcgcgcggggcaccccggcagcagggccccggg
accggcacccgcgacgttttccagaagagccgtttcgccccgcgcggcgccccgcacttt
cgtttcatcatagccgggcggcaggctgggaggcgctgccgcgggcgccttttccagact
gccttccccgcgccgtacgggcctagcccggcctcgcgctacgtgcagaaactgcccatg
atcggccgtaccagccgccccgcccgccggtgggcgctctcggactactcgctgtacttg
ccgctctga

DBGET integrated database retrieval system