KEGG   Homo sapiens (human): 10651Help
Entry
10651             CDS       T01001                                 

Gene name
MTX2
Definition
(RefSeq) metaxin 2
  KO
K17776  
metaxin
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Other outer membrane factor
    10651 (MTX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.1
AA seq 263 aa AA seqDB search
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCR
ANAEYMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLEEVQKAEMKAYMELVNN
MLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGKKTLD
QVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS
NLLAFCRRIEQHYFEDRGKGRLS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagtggcggaagccttcgtctcccagattgcagctgcagaaccttggcctgaa
aatgctacattatatcagcaattgaaaggggagcaaattttactttctgacaatgcagct
tctcttgcagtgcaggcctttttgcaaatgtgtaacttgcctatcaaagtagtttgtagg
gcaaatgcagaatatatgtctccatctggtaaagtaccttttattcatgtgggaaatcaa
gtagtatcagaacttggtccaatagtccaatttgttaaagccaagggccattctcttagt
gatgggctggaggaagtccaaaaagcagaaatgaaagcttacatggaattagtcaacaat
atgctgttgactgcagagctgtatcttcagtggtgtgatgaagctacagtaggggagatc
actcatgctaggtatggatctccttacccttggcctctgaatcatattttggcctatcaa
aaacagtgggaagtcaaacgtaagatgaaagctattggatggggaaagaagactctggac
caggtcttagaggatgtagaccagtgctgtcaagctctctctcaaagactgggaacacaa
ccgtatttcttcaataagcagcctactgaacttgacgcactggtatttggccatctatac
accattcttaccacacaattgacaaatgatgaactttctgagaaggtgaaaaactatagc
aacctccttgctttctgtaggagaattgaacagcactattttgaagatcgtggtaaaggc
aggctgtcatag

DBGET integrated database retrieval system