KEGG   Homo sapiens (human): 10652Help
Entry
10652             CDS       T01001                                 

Gene name
YKT6
Definition
YKT6 v-SNARE homolog (S. cerevisiae)
Orthology
K08516  
synaptobrevin homolog YKT6
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    10652 (YKT6)
SNAREs [BR:hsa04131]
 VAMP, Ykt6, Sec22 (R)
  Ykt6
   10652 (YKT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p15.1
AA seq 198 aa AA seqDB search
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVK
EQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHY
PALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQ
SKAFYKTARKQNSCCAIM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacagcctcagcgtcctctacaaaggcgaggccaaggtggtgctgctcaaa
gccgcatacgatgtgtcttccttcagctttttccagagatccagcgttcaggaattcatg
accttcacgagtcaactgattgtggagcgctcatcgaaaggcactagagcttctgtcaaa
gaacaagactatctgtgccacgtctacgtccggaatgatagtcttgcaggtgtggtcatt
gctgacaatgaatacccatcccgggtggcctttaccttgctggagaaggtactagatgaa
ttctccaagcaagtcgacaggatagactggccagtaggatcccctgctacaatccattac
ccagccctggatggtcacctcagtagataccagaacccacgagaagctgatcccatgact
aaagtgcaggccgaactagatgagaccaaaatcattctgcacaacaccatggagtctctg
ttagagcgaggtgagaagctagatgacttggtgtccaaatccgaggtgctgggaacacag
tctaaagccttctataaaactgcccggaaacaaaactcatgctgtgccatcatgtga

DBGET integrated database retrieval system