KEGG   Homo sapiens (human): 10652Help
Entry
10652             CDS       T01001                                 

Gene name
YKT6
Definition
(RefSeq) YKT6 v-SNARE homolog
  KO
K08516  synaptobrevin homolog YKT6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    10652 (YKT6)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    10652 (YKT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Longin
Motif
Other DBs
NCBI-GeneID: 10652
NCBI-ProteinID: NP_006546
OMIM: 606209
HGNC: 16959
Ensembl: ENSG00000106636
Vega: OTTHUMG00000129089
Pharos: O15498(Tbio)
UniProt: O15498 A4D2J0
Position
7p13
AA seq 198 aa AA seqDB search
MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVK
EQDYLCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHY
PALDGHLSRYQNPREADPMTKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQ
SKAFYKTARKQNSCCAIM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacagcctcagcgtcctctacaaaggcgaggccaaggtggtgctgctcaaa
gccgcatacgatgtgtcttccttcagctttttccagagatccagcgttcaggaattcatg
accttcacgagtcaactgattgtggagcgctcatcgaaaggcactagagcttctgtcaaa
gaacaagactatctgtgccacgtctacgtccggaatgatagtcttgcaggtgtggtcatt
gctgacaatgaatacccatcccgggtggcctttaccttgctggagaaggtactagatgaa
ttctccaagcaagtcgacaggatagactggccagtaggatcccctgctacaatccattac
ccagccctggatggtcacctcagtagataccagaacccacgagaagctgatcccatgact
aaagtgcaggccgaactagatgagaccaaaatcattctgcacaacaccatggagtctctg
ttagagcgaggtgagaagctagatgacttggtgtccaaatccgaggtgctgggaacacag
tctaaagccttctataaaactgcccggaaacaaaactcatgctgtgccatcatgtga

DBGET integrated database retrieval system