KEGG   Homo sapiens (human): 10658Help
Entry
10658             CDS       T01001                                 

Gene name
CELF1, BRUNOL2, CUG-BP, CUGBP, CUGBP1, EDEN-BP, NAB50, NAPOR, hNab50
Definition
CUGBP, Elav-like family member 1
Orthology
K13207  
CUG-BP- and ETR3-like factor
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11
AA seq 486 aa AA seqDB search
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSP
MVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTAS
SGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSGSS
PSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALT
QAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQM
FMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSK
NDSKPY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccctggaccacccagaccaaccagatcttgatgctatcaagatgtttgtg
ggccaggttccaaggacctggtctgaaaaggacttgcgggaactcttcgaacagtatggt
gctgtgtatgaaatcaacgtcctaagggataggagccaaaacccgcctcagagcaaaggg
tgctgttttgttacattttacacccgtaaagctgcattagaagctcagaatgctcttcac
aacatgaaagtcctcccagggatgcatcaccctatacagatgaaacctgctgacagtgag
aagaacaatgcagtggaagacaggaagctgtttattggtatgatttccaagaagtgcact
gaaaatgacatccgagtcatgttctcttcgtttggacagattgaagaatgccggatattg
cggggacctgatggcctgagccgaggttgtgcatttgtgacttttacaacaagagccatg
gcacagacggctatcaaggcaatgcaccaagcacagaccatggagggttgctcatcaccc
atggtggtaaaatttgctgatacacagaaggacaaagaacagaagagaatggcccagcag
ctccagcagcagatgcagcaaatcagcgcagcatctgtgtggggaaaccttgctggtcta
aatactcttggaccccagtatttagcactttatttgcagctccttcagcagactgcctcc
tctgggaacctcaacaccctgagcagcctccacccaatgggagggttgaatgcaatgcag
ttacagaatttggctgcactagctgctgcagctagtgcagctcagaacacaccaagtggt
accaatgctctcactacatccagcagtcccctcagcgtgctcactagttcagggtcctca
cctagctctagcagcagtaattctgtcaaccccatagcctcacttggagccctgcagaca
ttagctggagcaacggctggcctcaatgttggctctttggcaggaatggctgctttaaat
ggtggcctgggcagcagtggcctttccaatggcaccgggagcaccatggaggccctcact
caggcctactcgggtatccagcaatatgctgctgctgcgctccccactctgtacaaccag
aatcttctgacacagcagagtattggtgctgctggaagccagaaggaaggtccagaggga
gccaacctgttcatctaccacctgccccaggagtttggtgatcaggacctgctgcagatg
tttatgccctttgggaatgtcgtgtctgccaaggttttcatagacaagcagacaaacctg
agcaagtgttttggttttgtaagttacgacaatcctgtttcggcccaagctgccatccag
tccatgaacggctttcagattggcatgaagcggcttaaagtgcagctcaaacgttcgaag
aatgacagcaagccctactga

DBGET integrated database retrieval system