KEGG   Homo sapiens (human): 1066Help
Entry
1066              CDS       T01001                                 

Gene name
CES1, ACAT, CE-1, CEH, CES2, HMSE, HMSE1, PCE-1, REH, SES1, TGH, hCE-1
Definition
carboxylesterase 1 (EC:3.1.1.1 3.1.1.56)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    1066 (CES1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     1066 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.2
AA seq 567 aa AA seqDB search
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccgtgcctttatcctggccactctctctgcttccgcggcttgggggcatccg
tcctcgccacctgtggtggacaccgtgcatggcaaagtgctggggaagttcgtcagctta
gaaggatttgcacagcctgtggccattttcctgggaatcccttttgccaagccgcctctt
ggacccctgaggtttactccaccgcagcctgcagaaccatggagctttgtgaagaatgcc
acctcgtaccctcctatgtgcacccaagatcccaaggcggggcagttactctcagagcta
tttacaaaccgaaaggagaacattcctctcaagctttctgaagactgtctttacctcaat
atttacactcctgctgacttgaccaagaaaaacaggctgccggtgatggtgtggatccac
ggaggggggctgatggtgggtgcggcatcaacctatgatgggctggcccttgctgcccat
gaaaacgtggtggtggtgaccattcaatatcgcctgggcatctggggattcttcagcaca
ggggatgaacacagccgggggaactggggtcacctggaccaggtggctgccctgcgctgg
gtccaggacaacattgccagctttggagggaacccaggctctgtgaccatctttggagag
tcagcgggaggagaaagtgtctctgttcttgttttgtctccattggccaagaacctcttc
caccgggccatttctgagagtggcgtggccctcacttctgttctggtgaagaaaggtgat
gtcaagcccttggctgagcaaattgctatcactgctgggtgcaaaaccaccacctctgct
gtcatggttcactgcctgcgacagaagacggaagaggagctcttggagacgacattgaaa
atgaaattcttatctctggacttacagggagaccccagagagagtcaaccccttctgggc
actgtgattgatgggatgctgctgctgaaaacacctgaagagcttcaagctgaaaggaat
ttccacactgtcccctacatggtcggaattaacaagcaggagtttggctggttgattcca
atgcagttgatgagctatccactctccgaagggcaactggaccagaagacagccatgtca
ctcctgtggaagtcctatccccttgtttgcattgctaaggaactgattccagaagccact
gagaaatacttaggaggaacagacgacactgtcaaaaagaaagacctgttcctggacttg
atagcagatgtgatgtttggtgtcccatctgtgattgtggcccggaaccacagagatgct
ggagcacccacctacatgtatgagtttcagtaccgtccaagcttctcatcagacatgaaa
cccaagacggtgataggagaccacggggatgagctcttctccgtctttggggccccattt
ttaaaagagggtgcctcagaagaggagatcagacttagcaagatggtgatgaaattctgg
gccaactttgctcgcaatggaaaccccaatggggaagggctgccccactggccagagtac
aaccagaaggaagggtatctgcagattggtgccaacacccaggcggcccagaagctgaag
gacaaagaagtagctttctggaccaacctctttgccaagaaggcagtggagaagccaccc
cagacagaacacatagagctgtga

DBGET integrated database retrieval system