KEGG   Homo sapiens (human): 10667Help
Entry
10667             CDS       T01001                                 

Gene name
FARS2, COXPD14, FARS1, HSPC320, PheRS, dJ520B18.2
Definition
phenylalanyl-tRNA synthetase 2, mitochondrial (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    10667 (FARS2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     10667 (FARS2)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   10667 (FARS2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    10667 (FARS2)
 Prokaryotic Type
    10667 (FARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25.1
AA seq 451 aa AA seqDB search
MVGSALRRGAHAYVYLVSKASHISRGHQHQAWGSRPPAAECATQRAPGSVVELLGKSYPQ
DDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQYVGRFGTPLFSVYDNLSPVV
TTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRR
DQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVE
FDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVN
SAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKY
PAVINDISFWLPSENYAENDFYDLVRTIGGDLVEKVDLIDKFVHPKTHKTSHCYRITYRH
MERTLSQREVRHIHQALQEAAVQLLGVEGRF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtgggctcagctctcaggagaggtgcccatgcatatgtctacctggtgagtaaggcc
agtcacatctccagaggccatcagcaccaggcctggggatcgaggcctcctgcagcagag
tgtgccacccaaagagctccaggcagtgtggtggagctgctgggcaaatcctaccctcag
gacgaccacagcaacctcacccggaaggtcctcaccagagttggcaggaacctgcacaac
cagcagcatcaccctctgtggctgatcaaggagagggtgaaggagcacttctacaagcag
tatgtgggccgctttgggaccccgttgttctcggtctacgacaacctttctccagtggtc
acgacctggcagaactttgacagcctgctcatcccagctgatcaccccagcaggaagaag
ggggacaactattacctgaatcggactcacatgctgagagcgcacacgtctgcacaccag
tgggacttgctgcacgcgggactggatgccttcctggtggtgggtgatgtctacaggcgt
gaccagatcgactcccagcactaccctattttccaccagctggaggccgtgcggctcttc
tccaagcatgagttatttgctggtataaaggatggagaaagcctgcagctctttgaacaa
agttctcgctctgcgcataaacaagagacacacaccatggaggccgtgaagcttgtagag
tttgatcttaagcaaacgcttaccaggctcatggcacatctttttggagatgagctggag
ataagatgggtagactgctacttcccttttacacatccttcctttgagatggagatcaac
tttcatggagaatggctggaagttcttggctgcggggtgatggaacaacaactggtcaat
tcagctggtgctcaagaccgaatcggctgggcttttggcctaggattagaaaggctagcc
atgatcctctacgacatccctgatatccgtctcttctggtgtgaggacgagcgcttcctg
aagcagttctgtgtatccaacattaatcagaaggtgaagtttcagcctcttagcaaatat
ccggctgtgatcaatgatatttcattctggttgccctctgagaattacgcagaaaatgat
ttctatgacttagtccgaacaattggaggagacctggtggaaaaggttgatctcatagac
aagtttgtacatccaaagacgcacaagaccagccactgctaccgcatcacgtaccgccac
atggaacggactctgtcccagagagaggtcaggcacatccaccaggccttgcaggaggct
gcagtccagctgttgggtgtggagggcaggttctga

DBGET integrated database retrieval system