KEGG   Homo sapiens (human): 10670Help
Entry
10670             CDS       T01001                                 

Gene name
RRAGA, FIP-1, FIP1, RAGA
Definition
Ras-related GTP binding A
Orthology
K16185  
Ras-related GTP-binding protein A/B
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    10670 (RRAGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p22.1
AA seq 313 aa AA seqDB search
MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQL
IPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
ERVDGPKHSLLMR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacagccatgaagaaaaaggtgctgctgatggggaagagcgggtcggggaag
accagcatgaggtcgataatcttcgccaattacattgctcgcgacacccggcgcctgggg
gccaccattgacgtggaacactcccacgtccgattcctagggaacctggtgctgaacctg
tgggactgtggcggtcaggacaccttcatggaaaattacttcaccagccagcgagacaat
atcttccgtaacgtggaagttttgatttacgtgtttgacgtggagagccgcgaactggaa
aaggacatgcattattaccagtcgtgtctggaggccatcctccagaactctcctgacgcc
aaaatcttctgcctggtgcacaaaatggatctggttcaggaggatcagcgtgacctgatt
tttaaagagcgagaggaagacctgaggcgtctgtctcgcccgctggagtgtgcttgtttt
cgaacgtccatctgggatgagacgctctacaaagcctggtccagcatcgtctaccagctg
attcccaacgttcagcagctggagatgaacctcaggaattttgcccaaatcattgaggcc
gatgaagttctgctgttcgaaagagctacattcttggttatttcccactaccagtgcaaa
gagcagcgcgacgtccaccggtttgagaagatcagcaacatcatcaaacagttcaagctg
agctgcagtaaattggccgcttccttccagagcatggaagttaggaattccaacttcgct
gctttcatcgacatcttcacctcaaatacgtacgtgatggtggtcatgtcagatccgtcg
atcccttctgcggccactctgatcaacattcgcaatgcccggaaacactttgagaagctg
gagagagtggatggccccaagcacagtctccttatgcgttga

DBGET integrated database retrieval system