KEGG   Homo sapiens (human): 10672Help
Entry
10672             CDS       T01001                                 

Gene name
GNA13, G13
Definition
guanine nucleotide binding protein (G protein), alpha 13
Orthology
K04639  
guanine nucleotide-binding protein subunit alpha-13
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Long-term depression
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.3
AA seq 282 aa AA seqDB search
MRVLVDAREKLHIPWGDNSNQQHGDKMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWAD
SGIQNAYDRRREFQLGESVKYFLDNLDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKN
VPFKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETI
VNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRR
DQQQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgctggttgatgctcgagagaagcttcatattccctggggagacaactcaaac
caacaacatggagataagatgatgtcgtttgatacccgggcccccatggcagcccaagga
atggtggaaacaagggttttcttacaatatcttcctgctataagagcattatgggcagac
agcggcatacagaatgcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaa
tatttcctggataacttggataaacttggagaaccagattatattccatcacaacaagat
attctgcttgccagaagacccaccaaaggcatccatgaatacgactttgaaataaaaaat
gttcctttcaaaatggttgatgtaggtggtcagagatcagaaaggaaacgttggtttgaa
tgtttcgacagtgtgacatcaatacttttccttgtttcctcaagtgaatttgaccaggtg
cttatggaagatcgactgaccaatcgccttacagagtctctgaacatttttgaaacaatc
gtcaataaccgggttttcagcaatgtctccataattctgttcttaaacaagacagacttg
cttgaggagaaggtgcaaattgtgagcatcaaagactatttcctagaatttgaaggggat
ccccactgcttaagagacgtccaaaaattcctggtggaatgtttccggaacaaacgccgg
gaccagcaacagaagcccttataccaccacttcaccactgctatcaacacggagaacatc
cgccttgttttccgtgacgtgaaggatactattctgcatgacaacctcaagcagcttatg
ctacagtga

DBGET integrated database retrieval system