KEGG   Homo sapiens (human): 10672Help
Entry
10672             CDS       T01001                                 

Gene name
GNA13, G13
Definition
(RefSeq) G protein subunit alpha 13
  KO
K04639  
guanine nucleotide-binding protein subunit alpha-13
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Vascular smooth muscle contraction
Platelet activation
Long-term depression
Regulation of actin cytoskeleton
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    10672 (GNA13)
   04071 Sphingolipid signaling pathway
    10672 (GNA13)
   04022 cGMP - PKG signaling pathway
    10672 (GNA13)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10672 (GNA13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10672 (GNA13)
  Circulatory system
   04270 Vascular smooth muscle contraction
    10672 (GNA13)
  Nervous system
   04730 Long-term depression
    10672 (GNA13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10672 (GNA13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10672 (GNA13)
  Exosomal proteins of colorectal cancer cells
   10672 (GNA13)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    10672 (GNA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q24.3
AA seq 377 aa AA seqDB search
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcctgctg
acgagtggcgaggccgagcagcaacgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacctatgtgaagcggctggtgaagatcctgctgctgggcgcgggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggacttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagacaactcaaaccaacaacatggagat
aagatgatgtcgtttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcaactgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaaccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcatccatgaatacgactttgaaataaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgaatgtttcgacagtgtg
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcaacagaag
cccttataccaccacttcaccactgctatcaacacggagaacatccgccttgttttccgt
gacgtgaaggatactattctgcatgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system