KEGG   Homo sapiens (human): 10681Help
Entry
10681             CDS       T01001                                 

Gene name
GNB5, GB5
Definition
guanine nucleotide binding protein (G protein), beta 5
Orthology
K04539  
guanine nucleotide-binding protein subunit beta-5
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10681 (GNB5)
   04151 PI3K-Akt signaling pathway
    10681 (GNB5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10681 (GNB5)
  Nervous system
   04724 Glutamatergic synapse
    10681 (GNB5)
   04727 GABAergic synapse
    10681 (GNB5)
   04725 Cholinergic synapse
    10681 (GNB5)
   04728 Dopaminergic synapse
    10681 (GNB5)
   04726 Serotonergic synapse
    10681 (GNB5)
   04723 Retrograde endocannabinoid signaling
    10681 (GNB5)
  Environmental adaptation
   04713 Circadian entrainment
    10681 (GNB5)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    10681 (GNB5)
   05034 Alcoholism
    10681 (GNB5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10681 (GNB5)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    10681 (GNB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.2
AA seq 353 aa AA seqDB search
MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLK
GHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAI
ACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALW
DVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHES
DINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFA
GYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaggggctgcacgagaacgagacgctggcgtcgctgaagagcgaggccgag
agcctcaagggcaagctggaggaggagcgagccaagctgcacgatgtggagctgcaccag
gtggcggagcgggtggaggccctggggcagtttgtcatgaagaccagaaggaccctcaaa
ggccacgggaacaaagtcctgtgcatggactggtgcaaagataagaggaggatcgtgagc
tcgtcacaggatgggaaggtgatcgtgtgggattccttcaccacaaacaaggagcacgcg
gtcaccatgccctgcacgtgggtgatggcatgtgcttatgccccatcgggatgtgccatt
gcttgtggtggtttggataataagtgttctgtgtaccccttgacgtttgacaaaaatgaa
aacatggctgccaaaaagaagtctgttgctatgcacaccaactacctgtcggcctgcagc
ttcaccaactctgacatgcagatcctgacagcgagcggcgatggcacatgtgccctgtgg
gacgtggagagcgggcagctgctgcagagcttccacggacatggggctgacgtcctctgc
ttggacctggccccctcagaaactggaaacaccttcgtgtctgggggatgtgacaagaaa
gccatggtgtgggacatgcgctccggccagtgcgtgcaggcctttgaaacacatgaatct
gacatcaacagtgtccggtactaccccagtggagatgcctttgcttcagggtcagatgac
gctacgtgtcgcctctatgacctgcgggcagatagggaggttgccatctattccaaagaa
agcatcatatttggagcatccagcgtggacttctccctcagtggtcgcctgctgtttgct
ggatacaatgattacactatcaacgtctgggatgttctcaaagggtcccgggtctccatc
ctgtttggacatgaaaaccgcgttagcactctacgagtttcccccgatgggactgctttc
tgctctggatcatgggatcataccctcagagtctgggcctaa

DBGET integrated database retrieval system