KEGG   Homo sapiens (human): 10683Help
Entry
10683             CDS       T01001                                 

Gene name
DLL3, SCDO1
Definition
delta-like 3 (Drosophila)
Orthology
K06051  
delta
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Disease
H00517  
Spondylocostal dysostosis (SCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    10683 (DLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 618 aa AA seqDB search
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggtctccccacggatgtccgggctcctctcccagactgtgatcctagcgctcattttc
ctcccccagacacggcccgctggcgtcttcgagctgcagatccactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagcgcccggctcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcagaggaggccgccgagtccccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctttcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgcgtggctggcaggcggcgcttggcagccggaggcccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgccgtcgggaccgcgtgcacgcgcctctgccgtccgcgcagcgccccctcgcggtgc
ggtccgggactgcgcccctgcgcaccgctcgaggacgaatgtgaggcgccgctggtgtgc
cgagcaggctgcagccctgagcatggcttctgtgaacagcccggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccgtcctctgctaccaccggatgccttgtccctgggcctgggccctgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccaggtcctttgaatgcacctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcagatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtcctcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtctgcgcttgcgctcccggctacatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgccttgcccgcggccccg
ccgggcctcaggcccggggaccctcagcgctaccttttgcctccggctctgggactgctc
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
tcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggttccggggatggtccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcaagggatttatgtcatatctgctcct
tccatctacgctcgggaggtagcgacgccccttttccccccgctacacactgggcgcgct
gggcagaggcagcacctgctttttccctacccttcctcgattctgtccgtgaaatga

DBGET integrated database retrieval system