KEGG   Homo sapiens (human): 10724Help
Entry
10724             CDS       T01001                                 

Gene name
MGEA5, MEA5, NCOAT, OGA
Definition
meningioma expressed antigen 5 (hyaluronidase) (EC:2.3.1.48 3.2.1.169)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     10724 (MGEA5)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     10724 (MGEA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24.1-q24.3
AA seq 863 aa AA seqDB search
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMSRQVAHSGAKASVVD
GTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQE
ETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQT
NKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVS
VNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSM
VKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSK
VYTIRPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDE
DGICGYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPE
TFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSK
LGCFEIAKMEGFPKDVVILGRSL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagtcaagcgacgttggaggagcgggagagcgagctcagctccaac
cctgccgcctctgcgggggcatcgctggagccgccggcagctccggcacccggagaagac
aaccccgccggggctgggggagcggcggtggccggggctgcaggaggggctcggcggttc
ctctgcggtgtggtggaaggattttatggaagaccttgggttatggaacagagaaaagaa
ctctttagaaggctccagaaatgggaattaaatacatacttgtatgccccaaaagatgac
tacaaacataggatgttttggcgagagatgtattcagtggaggaagctgagcaacttatg
actctcatctctgctgcacgagaatatgagatagagttcatctatgcgatctcacctgga
ttggatatcactttttctaaccccaaggaagtatccacattgaaacgtaaattggaccag
gtttctcagtttgggtgcagatcatttgctttgctttttgatgatatagaccataatatg
tgtgcagcagacaaagaggtattcagttcttttgctcatgcccaagtctccatcacaaat
gaaatctatcagtacctaggagagccagaaactttcctcttctgtcccacagaatactgt
ggcactttctgttatccaaatgtgtctcagtctccatatttaaggactgtgggtgaaaag
cttctacctggaattgaagtgctttggacaggtcccaaagttgtttctaaagaaattcca
gtagagtccatcgaagaggtttctaagattattaagagagctccagtaatctgggataac
attcatgctaatgattatgatcagaagagactgtttctgggcccgtacaaaggaagatcc
acagaactcatcccacggttaaaaggagtcctcactaatccaaattgtgaatttgaagcc
aactacgttgctatccacacccttgccacctggtacaaatcaaacatgaatggagtgaga
aaagatgtagtgatgagtaggcaagttgcacacagtggagctaaagcaagtgtagttgat
gggactcctttagttgcagcaccctctttaaatgccacaaccgtagtaacaacagtttat
caggagcccattatgagccagggagcagccttgagtggtgagcctactactctgaccaag
gaagaagaaaagaaacagcctgatgaagaacccatggacatggtggtggaaaaacaagaa
gaaacggaccacaagaatgacaatcaaatactgagtgaaattgttgaagcgaaaatggca
gaggaattgaaaccaatggacactgataaagagagcatagctgaatcaaaatccccagag
atgtccatgcaagaagattgtattagtgacattgcccccatgcaaactgatgaacagaca
aacaaggagcagtttgtgccaggtccaaatgaaaagcctttgtacactgcggaaccagtg
accctggaggatttgcagttacttgctgatctattctaccttccttacgagcatggaccc
aaaggagcacagatgttacgggaatttcaatggcttcgagcaaatagtagtgttgtcagt
gtcaattgcaaaggaaaagactctgaaaaaattgaagaatggcggtcacgagcagccaag
tttgaagagatgtgtggactagtgatgggaatgttcactcggctctccaattgtgccaac
aggacaattctttatgacatgtactcctatgtttgggatatcaagagtataatgtctatg
gtgaagtcttttgtacagtggttagggtgtcgtagtcattcttcagcacaattcttaatt
ggagaccaagaaccctgggcctttagaggtggtctagcaggagagttccagcgtttgctg
ccaattgatggggcaaatgatctcttttttcagccacctccactgactcctacctccaaa
gtttatactatcagaccttattttcctaaggatgaggcatccgtgtacaagatttgcaga
gaaatgtatgacgatggagtgggtttaccctttcaaagtcagcctgatcttattggagac
aagttagtaggagggctgctttccctcagcctggattactgctttgtcctagaagatgaa
gatggcatatgtggttatgccttgggcactgtagatgtgaccccctttattaaaaaatgt
aaaatttcctggatccccttcatgcaggagaagtataccaagccaaatggtgacaaggaa
ctctctgaggctgagaaaataatgttgagtttccatgaagaacaggaagtactgccagaa
actttccttgctaatttcccttctctgataaagatggacattcacaaaaaagtaactgac
ccaagtgtggccaaaagcatgatggcttgcctcctgtcttcactgaaggctaatggctcc
cggggagctttctgtgaagtgagaccagatgataaaagaattctggaattttacagcaag
ttaggatgttttgaaattgcaaaaatggaaggatttccaaaggatgtggttatacttggt
cggagcctgtga

DBGET integrated database retrieval system