KEGG   Homo sapiens (human): 10734Help
Entry
10734             CDS       T01001                                 

Gene name
STAG3
Definition
stromal antigen 3
Orthology
K13055  
cohesin complex subunit SA-3
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 1225 aa AA seqDB search
MSSPLQRAVGDTKRALSASSSSSASLPFDDRDSNHTSEGNGDSLLADEDTDFEDSLNRNV
KKRAAKRPPKTTPVAKHPKKGSRVVHRHSRKQSEPPANDLFNAVKAAKSDMQSLVDEWLD
SYKQDQDAGFLELVNFFIQSCGCKGIVTPEMFKKMSNSEIIQHLTEQFNEDSGDYPLIAP
GPSWKKFQGSFCEFVRTLVCQCQYSLLYDGFPMDDLISLLTGLSDSQVRAFRHTSTLAAM
KLMTSLVKVALQLSVHQDNNQRQYEAERNKGPGQRAPERLESLLEKRKELQEHQEEIEGM
MNALFRGVFVHRYRDVLPEIRAICIEEIGCWMQSYSTSFLTDSYLKYIGWTLHDKHREVR
LKCVKALKGLYGNRDLTTRLELFTSRFKDRMVSMVMDREYDVAVEAVRLLILILKNMEGV
LTDADCESVYPVVYASHRGLASAAGEFLYWKLFYPECEIRMMGGREQRQSPGAQRTFFQL
LLSFFVESELHDHAAYLVDSLWDCAGARLKDWEGLTSLLLEKDQNLGDVQESTLIEILVS
SARQASEGHPPVGRVTGRKGLTSKERKTQADDRVKLTEHLIPLLPQLLAKFSADAEKVTP
LLQLLSCFDLHIYCTGRLEKHLELFLQQLQEVVVKHAEPAVLEAGAHALYLLCNPEFTFF
SRADFARSQLVDLLTDRFQQELEELLQSSFLDEDEVYNLAATLKRLSAFYNTHDLTRWEL
YEPCCQLLQKAVDTGEVPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAF
CELCQSCLSDVDTEIQEQAFVLLSDLLLIFSPQMIVGGRDFLRPLVFFPEATLQSELASF
LMDHVFIQPGDLGSGDSQEDHLQIERLHQRRRLLAGFCKLLLYGVLEMDAASDVFKHYNK
FYNDYGDIIKETLTRARQIDRSHCSRILLLSLKQLYTELLQEHGPQGLNELPAFIEMRDL
ARRFALSFGPQQLQNRDLVVMLHKEGIQFSLSELPPAGSSNQPPNLAFLELLSEFSPRLF
HQDKQLLLSYLEKCLQHVSQAPGHPWGPVTTYCHSLSPVENTAETSPQVLPSSKRRRVEG
PAKPNREDVSSSQEESLQLNSIPPTPTLTSTAVKSRQPLWGLKEMEEEDGSELDFAQGQP
VAGTERSRFLGPQYFQTPHNPSGPGLGNQLMRLSLMEEDEEEELEIQDESNEERQDTDMQ
ASSYSSTSERGLDLLDSTELDIEDF
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccgttgcaaagagctgtgggagataccaagagggccttgtctgcatcttct
agttcctctgccagtctaccctttgatgacagggactcaaaccatacctcagaggggaat
ggcgactctttgttagctgatgaagacactgactttgaagacagcttgaatcgcaatgtg
aagaagagagcagcaaaacgaccaccgaaaacaacaccggtggcaaaacatccaaagaaa
gggtcccgagtggtacatcgtcatagccggaaacagtcagagccaccagccaatgatctt
ttcaatgctgtgaaagccgccaaaagtgacatgcagtctttggtagatgagtggctggat
agctacaagcaagaccaggatgcaggatttctggagcttgttaactttttcatccaatct
tgcggatgtaaaggcattgtgacccctgagatgttcaagaagatgtccaactcagagatc
atccagcacctaacagagcagtttaatgaggactcgggggactaccctctcatagctcca
ggtccatcctggaagaagttccagggcagcttctgtgaatttgtgaggacattggtctgt
cagtgccagtacagcctcctctatgatggcttccctatggacgacctcatctccctgctc
actggcctctcagactcacaagtccgcgccttccgtcacactagcaccctggctgctatg
aaactgatgacctccctggtaaaagttgccctccaactgagtgtgcaccaagataacaat
cagcgtcagtatgaggctgaaagaaacaaggggccagggcagagggcacctgagcggctg
gagagcctgttggagaaacgcaaagagctccaagagcatcaagaggagattgaggggatg
atgaatgccctcttcaggggtgtctttgttcatcggtacagggatgtccttcctgagatc
cgtgctatctgcattgaggaaattgggtgttggatgcaaagctacagcacgtctttcctc
accgacagctatttaaaatatattggttggactctgcatgataagcaccgagaagtccgc
ctgaagtgtgtgaaggccctgaaagggctgtacggtaaccgggacctgaccacacgcctg
gagctcttcaccagccgcttcaaggaccggatggtttccatggtcatggacagagagtat
gatgtggcagtggaggctgtcagattactgatacttatccttaagaacatggaaggggtg
ctgacggacgcggattgtgagagcgtctacccagttgtgtatgcctctcatcgaggcctg
gcctctgccgcaggcgaatttctgtactggaaactcttctaccctgagtgcgagataaga
atgatgggtggaagagagcaacgccagagcccaggcgcccagaggactttcttccagctt
ctgctgtccttctttgtggagagcgagctccatgaccacgctgcttacttagtagacagt
ctgtgggactgtgcaggggctcggctgaaggactgggagggtctgacaagcctgctgctg
gagaaggaccagaacctgggtgatgtgcaggagagcacactgatagaaatccttgtgtcc
agtgcccggcaagcttcagaggggcacccgcctgtgggccgggtcactgggaggaagggc
ttaacctctaaggagcgcaagacccaagccgatgacagggtgaagttgactgagcacctc
atccccctgctgccccagctcctggccaagttctcagctgatgcagagaaggtcactccc
ctgctccagcttctcagctgctttgacctccacatctactgcactgggcgcttggagaag
cacctggagctgttcctgcagcaactccaggaggtggtggtgaagcatgcagagccagcg
gtgcttgaggctggggcgcatgccctctacctgctctgtaatcccgaattcactttcttc
agccgggcggactttgcccgcagccagctagtagatttgctgactgaccgcttccagcag
gagcttgaagagctgttacagtcgtccttcctagatgaggatgaggtatataatctggca
gccactctgaaacgcctctctgccttctacaacactcatgacctgactcgctgggagctc
tatgagccatgttgccaactcctgcagaaggctgtggacacaggagaggttcctcaccag
gttatcctgccagccttgactcttgtctatttttccattctctggacactaacccacatt
tctaaatcagatgcttcccagaagcagctgtcgagtttgagggacagaatggtggccttc
tgtgaactctgccagagttgcctctcagatgtggatactgagatccaggagcaggctttt
gtcttattaagtgatctacttctcatctttagccctcagatgattgttgggggccgtgat
ttccttaggccacttgtcttttttcctgaagctactctccagtctgagctagccagcttc
ctcatggaccacgtcttcatccagccgggagacctgggcagtggtgattcccaggaggat
catttacagatagagcggctacaccagcggcgccgcctcctagccgggttctgcaagctg
ttgctttatggggtgctggagatggatgcagcctcagatgttttcaaacactacaacaag
ttctacaatgactatggtgacattatcaaggaaacattaactagagcaaggcagattgac
cgaagtcattgttcccgaatcctgctgctgagcctcaagcagctgtacacagaactgctg
caggagcatgggccccagggcctgaatgagcttcctgccttcatcgagatgagggacctg
gcccggaggtttgccttgagttttggaccccagcagctgcagaaccgtgacctcgtggtc
atgctacacaaggaaggcatccagttctccttgtctgagcttcctccagctggctcctcc
aatcagcctccaaatctggcattcctggagctcctttcagagttttccccccgactcttc
catcaggacaagcagcttttactgtcctatctagaaaagtgcctgcagcatgtctcccag
gcacctggccatccctggggcccagtcaccacctactgccactccctcagccctgtggag
aacacagcagagaccagccctcaggtcctccccagctccaagaggaggcgcgttgaaggg
cctgccaagcctaacagagaggacgtctcctcgtcccaggaagaaagtctgcagctgaac
agcatcccgcccacgcccaccctcacctccacagctgtgaagagcaggcagcccctgtgg
gggttgaaagagatggaggaagaagatggctcagagttggattttgcccagggtcagccc
gtcgcaggcaccgagaggtcaaggttcttgggtccacaatatttccagactccacacaac
ccttcaggtcctggcctgggcaaccagctgatgcgactcagccttatggaagaggacgag
gaagaagagttagaaatccaggatgagtcaaatgaagaacggcaggatacagacatgcaa
gcaagtagctactcttccaccagtgagcgcgggctggacctcttagattctacagagctg
gatattgaggatttctga

DBGET integrated database retrieval system