KEGG   Homo sapiens (human): 10735Help
Entry
10735             CDS       T01001                                 

Gene name
STAG2, SA-2, SA2, SCC3B, bA517O1.1
Definition
stromal antigen 2
Orthology
K06671  
cohesin complex subunit SA-1/2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10735 (STAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq25
AA seq 1268 aa AA seqDB search
MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGG
GKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINF
FIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG
VLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIN
MDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA
IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKEL
NSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYL
VDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVG
RGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIY
TTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDE
LADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGI
ENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVN
TTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDII
KETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFG
LDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYV
YLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTG
KRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMS
VYPMQTEHHQTPLDYNTQVTWMLAQRQQEEARQQQERAAMSYVKLRTNLQHAIRRGTSLM
EDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDE
SVLGVSMF
NT seq 3807 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagctccagaaataccaactgattttaatctactacaggagtcagaaacacat
ttttcttctgacacagattttgaagatatcgaaggaaaaaaccaaaagcaaggcaaaggc
aaaacttgtaaaaaaggcaaaaagggcccagcagaaaagggcaaaggtggaaatggagga
ggaaaacctccttctggtccaaaccgaatgaatggtcatcaccaacagaatggagtggaa
aacatgatgttgtttgaagttgttaaaatgggcaagagtgctatgcagtcggtggtagat
gattggatagaatcatacaagcatgaccgagatatagcacttcttgaccttatcaacttt
tttattcagtgttcaggctgtaaaggagttgtcacagcagaaatgtttagacatatgcag
aactctgagataattcgaaaaatgactgaagaattcgatgaggatagtggagattatcca
cttaccatggctggtcctcagtggaagaagttcaaatccagtttttgtgaattcattggc
gtgttagtacggcaatgtcaatatagtatcatatatgatgagtatatgatggatacagtc
atttcacttcttacaggattgtctgactcacaagtcagagcatttcgacatacaagcacc
ctggcagctatgaagttgatgacagctttggtgaatgtggcactaaatcttagcattaat
atggataatacacaaagacaatatgaagcagaacggaataaaatgattggaaaacgagcc
aatgagaggctagaactcctgctacaaaagcggaaagagcttcaggaaaatcaagatgaa
atagaaaatatgatgaatgcaatatttaaaggagtgtttgtacatagataccgtgatgcg
atagctgaaattcgagctatttgcattgaagagattggcatttggatgaagatgtatagt
gatgcctttcttaatgacagttatttaaaatatgttggttggactatgcatgataagcaa
ggtgaagtaagactcaaatgtcttactgctctacaagggctttattataacaaagagctt
aattccaaactggaactttttaccagtcggttcaaggatagaattgtgtctatgaccctt
gacaaagaatatgatgttgcagtacaagcaataaaattactcactcttgttttacagagt
agtgaagaagttctcactgcagaagattgtgaaaatgtctatcatctggtttattcagct
caccggccagtagcagtagcagctggagaatttctctacaaaaagctcttcagtcgtaga
gatccagaggaggatggaatgatgaaaagaagaggaagacaaggtccaaatgccaacctt
gttaagacattggtttttttctttctagaaagtgagttacatgagcatgcagcatacctt
gtggatagcatgtgggactgtgctactgagctgctgaaagactgggaatgtatgaatagc
ttgttactggaagagccacttagtggagaggaagcactaacagataggcaagagagtgct
ctgattgaaataatgctttgtaccattagacaagcggctgaatgtcatcctcccgtggga
agagggacaggaaaaagggtgcttacagcaaaggagaagaagacacagttggatgatagg
acaaaaatcactgagctttttgccgtggcccttcctcagttattagcaaaatactctgta
gatgcagaaaaggtgactaacttgttgcagttgcctcagtactttgatttggaaatatat
accactggacgattagaaaagcatttggatgccttattgcgacagatccggaatattgta
gagaagcacacagatacagatgttttggaagcatgttctaaaacttaccatgcactctgt
aatgaagagttcacaatcttcaacagagtagatatttcaagaagtcaactgatagatgaa
ttggcagataaatttaaccggcttcttgaagattttctgcaagagggtgaagaacctgat
gaagatgatgcatatcaggtattgtcaacattgaagaggatcactgcttttcataatgcc
catgacctttcaaagtgggatttatttgcttgtaattacaaactcttgaaaactggaatc
gaaaatggagacatgcctgagcagattgttattcacgcactgcagtgtactcactatgta
atcctttggcaacttgctaagataactgaaagcagctctacaaaggaggacttgctgcgt
ttaaagaaacaaatgagagtattttgtcagatatgtcaacattacctgaccaacgtgaat
actactgttaaggaacaggccttcactattctgtgtgatattttgatgatcttcagccat
cagattatgtcaggagggcgtgacatgttagagccattagtgtatacccctgattcttca
ttgcagtctgagttgctcagctttattttggatcatgtcttcattgaacaggatgatgat
aataatagtgcagatggtcagcaagaggatgaagccagtaaaattgaagctctgcacaag
agaagaaatttacttgcagcattttgtaagctaattgtatatactgtggtggagatgaat
acagctgcagatatcttcaaacagtatatgaagtattataatgactatggagatatcatc
aaagaaacaatgagtaaaacaaggcagatagacaaaattcagtgtgctaagacccttatt
ctcagtctgcaacagctttttaatgaaatgatacaagaaaatggctataattttgataga
tcatcctctacatttagtggcataaaagaacttgctcgacgttttgctttaacttttgga
cttgatcagttgaaaacaagagaagccattgccatgctacacaaagatggcatagaattt
gcttttaaagagcctaatccgcaaggggagagccatccacctttaaatttggcatttctt
gatattctgagtgaattttcttctaaactacttcgacaagacaaaagaacagtgtatgtt
tacttggaaaagttcatgacctttcagatgtcactccgaagagaggatgtgtggcttcca
ctgatgtcttaccgaaattctttgctagctggtggtgatgatgacaccatgtcagtcatt
agtggaatcagcagccgggggtcaacagtacggagtaaaaaatcaaaaccatctacagga
aaacggaaagtggttgagggcatgcagctttcactcactgaagaaagtagtagtagtgac
agtatgtggttaagcagagaacaaacactgcacacccctgttatgatgcagacaccacaa
ctcacctccactattatgagagagcccaaaagattacggcctgaggatagcttcatgagt
gtttatccaatgcagactgaacatcatcaaacacctcttgattataacacgcaggtaaca
tggatgttagctcaaagacaacaagaggaagcaaggcaacagcaggagagagcagcaatg
agctatgttaaactgcgaactaatcttcagcatgccattcggcgtggcacaagcctaatg
gaagatgatgaagagccaattgtggaagatgttatgatgtcctcagaagggaggattgag
gatcttaatgagggaatggattttgacaccatggatatagatttgccaccatcaaagaac
agacgagagagaacagaactgaagcctgatttctttgatccagcttcaattatggatgaa
tcagttcttggagtgtcaatgttttaa

DBGET integrated database retrieval system