KEGG   Homo sapiens (human): 10744Help
Entry
10744             CDS       T01001                                 

Gene name
PTTG2
Definition
pituitary tumor-transforming 2
Orthology
K06635  
securin
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10744 (PTTG2)
   04114 Oocyte meiosis
    10744 (PTTG2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    10744 (PTTG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p12
AA seq 191 aa AA seqDB search
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT
RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF
NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLFA
VSFKHSVDPGC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgatctacgttgataaggaaattggagaaccaggcacccgtgtggctgcc
aaggatgtgctgaagctggagtctagaccttcaatcaaagcattagatgggatatctcaa
gttttaacacgacgttttggcaaaacatacgatgctccatcagccttacctaaagctacc
agaaaggctttgggcactgtcaacagagctacagaaaagtcagtaaagaccaatggaccc
agaaaacaaaaacagccaagcttttctgccaaaaagatgaccgagaagactgttaaaaca
aaaagttctgttcctgcctcagatgacgcctatccagaaatagaaaaattctttcccttc
aatcttctagactttgagagttttgacctgcctgaagagcgccagattgcacacctcccc
ttgagtggagtgcctctcatgatccttgatgaggagggagagcttgaaaagctgtttcag
ctgggccccccttcacctgtgaaaatgccctctccaccatgggaatgcaatctgtttgca
gtctccttcaagcattctgtcgaccctggatgttga

DBGET integrated database retrieval system