KEGG   Homo sapiens (human): 10744Help
Entry
10744             CDS       T01001                                 

Gene name
PTTG2
Definition
(RefSeq) pituitary tumor-transforming 2
  KO
K06635  securin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa05166  HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10744 (PTTG2)
   04114 Oocyte meiosis
    10744 (PTTG2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    10744 (PTTG2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Securin
    10744 (PTTG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Securin
Motif
Other DBs
NCBI-GeneID: 10744
NCBI-ProteinID: NP_006598
OMIM: 604231
HGNC: 9691
Ensembl: ENSG00000250254
Vega: OTTHUMG00000160424
Pharos: Q9NZH5(Tdark)
UniProt: Q9NZH5
Position
4p14
AA seq 191 aa AA seqDB search
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT
RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF
NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLFA
VSFKHSVDPGC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctactctgatctacgttgataaggaaattggagaaccaggcacccgtgtggctgcc
aaggatgtgctgaagctggagtctagaccttcaatcaaagcattagatgggatatctcaa
gttttaacacgacgttttggcaaaacatacgatgctccatcagccttacctaaagctacc
agaaaggctttgggcactgtcaacagagctacagaaaagtcagtaaagaccaatggaccc
agaaaacaaaaacagccaagcttttctgccaaaaagatgaccgagaagactgttaaaaca
aaaagttctgttcctgcctcagatgacgcctatccagaaatagaaaaattctttcccttc
aatcttctagactttgagagttttgacctgcctgaagagcgccagattgcacacctcccc
ttgagtggagtgcctctcatgatccttgatgaggagggagagcttgaaaagctgtttcag
ctgggccccccttcacctgtgaaaatgccctctccaccatgggaatgcaatctgtttgca
gtctccttcaagcattctgtcgaccctggatgttga

DBGET integrated database retrieval system