KEGG   Homo sapiens (human): 10746Help
Entry
10746             CDS       T01001                                 

Gene name
MAP3K2, MEKK2, MEKK2B
Definition
mitogen-activated protein kinase kinase kinase 2 (EC:2.7.11.25)
Orthology
K04420  
mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    10746 (MAP3K2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    10746 (MAP3K2)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    10746 (MAP3K2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     10746 (MAP3K2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   10746 (MAP3K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.3
AA seq 619 aa AA seqDB search
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggagcagagaggaaaaaacggctatctataataggtcctactagtaga
gatagaagttctcctcccccaggttacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggctcagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccaaggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgaccccgatagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacgggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacggatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

DBGET integrated database retrieval system