KEGG   Homo sapiens (human): 10746Help
Entry
10746             CDS       T01001                                 

Gene name
MAP3K2, MEKK2, MEKK2B
Definition
mitogen-activated protein kinase kinase kinase 2 (EC:2.7.11.25)
Orthology
K04420  
mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.3
AA seq 619 aa AA seqDB search
MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFP
RPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLV
INGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARN
GSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQSY
PDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSLRSPVS
FSPTDHSLSTSSGSSIFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGK
LLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQ
YYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIV
HRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR
KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVE
AKLRPSADELLRHMFVHYH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagcaagctttgaactcaatcatgcaagatttggctgtccttcataaggcc
agtcgaccagcattatccttgcaggaaaccagaaaagcaaaatcttcatcaccaaaaaaa
cagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttcccc
agaccagttaaactggaagatctgagatctaaagctaaaattgcctttggacagtctatg
gatctacattataccaataacgagttggtaattccattaactactcaagatgacttggac
aaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagatattacttgta
ataaatggaagtacacaggctactaatttagaaccattgccatcactagaagatttggat
aatacagtatttggagcagagaggaaaaaacggctatctataataggtcctactagtaga
gatagaagttctcctcccccaggttacattccagatgaattacaccaggttgcccggaat
gggtcattcactagtatcaacagtgaaggagagttcattccagagagcatggaccaaatg
ctggatccattatctttaagcagccctgaaaattctggctcaggaagttgtccatcactt
gatagtcctttggatggagagagctatccaaaatcacgaatgcctagggctcagagctac
ccagataatcatcaggaattttcagactatgataaccctatctttgagaaatttggaaaa
ggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagagtataatgatggt
cgtaaaacttttccaagagctagaaggacccaggggaccagcttacggtctcctgtgagt
ttcagtcctactgatcattccttaagcactagtagtggaagcagtatctttaccccagag
tatgatgatagtcgaataagaagaaggggaagtgacatagacaatcctactttgaccgta
atggacatcagcccacccagccgttcacctcgagctccgaccaactggagattgggcaaa
ctgcttggccaaggagcctttggaagggtctacctctgttatgatgttgatacaggaaga
gaattggctgttaagcaagttcaatttgaccccgatagtcctgagaccagcaaggaagta
aatgcacttgagtgtgaaattcagttgctgaaaaacttgctacatgagcgaattgttcag
tattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaatatatg
ccagggggttcaattaaggaccaattaaaagcatatggcgctcttactgagaatgtgact
aggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatgattgtc
catagagatatcaaaggcgcaaatatcctgcgagattcaacaggcaacgtcaaactagga
gattttggggccagcaaacggcttcagaccatctgtctctcagggacaggaatgaagtct
gtcacgggcacaccatactggatgagccctgaagtcatcagtggagaaggctatggaaga
aaagcagacatctggagtgttgcatgtactgtggtagaaatgctaactgaaaagccgcct
tgggctgaatttgaagcaatggctgccatctttaaaatcgccactcagccaacaaaccca
aagctgccacctcatgtctcagactatactcgagatttcctcaaacggatttttgtagag
gccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcattatcactag

DBGET integrated database retrieval system