KEGG   Homo sapiens (human): 10747Help
Entry
10747             CDS       T01001                                 

Gene name
MASP2, MAP19, MASP-2, MASP1P1, sMAP
Definition
(RefSeq) mannan binding lectin serine peptidase 2
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Disease
H00105  Mannose-binding lectin pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    10747 (MASP2)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    10747 (MASP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     10747 (MASP2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   10747 (MASP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Sushi EGF_CA FXa_inhibition cEGF CUB_2 EGF
Motif
Other DBs
NCBI-GeneID: 10747
NCBI-ProteinID: NP_006601
OMIM: 605102
HGNC: 6902
Ensembl: ENSG00000009724
Vega: OTTHUMG00000002121
Pharos: O00187(Tbio)
UniProt: O00187
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 686 aa AA seqDB search
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISDF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgaccctcctgggccttctgtgtggctcggtggccacccccttgggcccg
aagtggcctgaacctgtgttcgggcgcctggcatcccccggctttccaggggagtatgcc
aatgaccaggagcggcgctggaccctgactgcaccccccggctaccgcctgcgcctctac
ttcacccacttcgacctggagctctcccacctctgcgagtacgacttcgtcaagctgagc
tcgggggccaaggtgctggccacgctgtgcgggcaggagagcacagacacggagcgggcc
cctggcaaggacactttctactcgctgggctccagcctggacattaccttccgctccgac
tactccaacgagaagccgttcacggggttcgaggccttctatgcagccgaggacattgac
gagtgccaggtggccccgggagaggcgcccacctgcgaccaccactgccacaaccacctg
ggcggtttctactgctcctgccgcgcaggctacgtcctgcaccgtaacaagcgcacctgc
tcagccctgtgctccggccaggtcttcacccagaggtctggggagctcagcagccctgaa
tacccacggccgtatcccaaactctccagttgcacttacagcatcagcctggaggagggg
ttcagtgtcattctggactttgtggagtccttcgatgtggagacacaccctgaaaccctg
tgtccctacgactttctcaagattcaaacagacagagaagaacatggcccattctgtggg
aagacattgccccacaggattgaaacaaaaagcaacacggtgaccatcacctttgtcaca
gatgaatcaggagaccacacaggctggaagatccactacacgagcacagcgcagccttgc
ccttatccgatggcgccacctaatggccacgtttcacctgtgcaagccaaatacatcctg
aaagacagcttctccatcttttgcgagactggctatgagcttctgcaaggtcacttgccc
ctgaaatcctttactgcagtttgtcagaaagatggatcttgggaccggccaatgcccgcg
tgcagcattgttgactgtggccctcctgatgatctacccagtggccgagtggagtacatc
acaggtcctggagtgaccacctacaaagctgtgattcagtacagctgtgaagagaccttc
tacacaatgaaagtgaatgatggtaaatatgtgtgtgaggctgatggattctggacgagc
tccaaaggagaaaaatcactcccagtctgtgagcctgtttgtggactatcagcccgcaca
acaggagggcgtatatatggagggcaaaaggcaaaacctggtgattttccttggcaagtc
ctgatattaggtggaaccacagcagcaggtgcacttttatatgacaactgggtcctaaca
gctgctcatgccgtctatgagcaaaaacatgatgcatccgccctggacattcgaatgggc
accctgaaaagactatcacctcattatacacaagcctggtctgaagctgtttttatacat
gaaggttatactcatgatgctggctttgacaatgacatagcactgattaaattgaataac
aaagttgtaatcaatagcaacatcacgcctatttgtctgccaagaaaagaagctgaatcc
tttatgaggacagatgacattggaactgcatctggatggggattaacccaaaggggtttt
cttgctagaaatctaatgtatgtcgacataccgattgttgaccatcaaaaatgtactgct
gcatatgaaaagccaccctatccaaggggaagtgtaactgctaacatgctttgtgctggc
ttagaaagtgggggcaaggacagctgcagaggtgacagcggaggggcactggtgtttcta
gatagtgaaacagagaggtggtttgtgggaggaatagtgtcctggggttccatgaattgt
ggggaagcaggtcagtatggagtctacacaaaagttattaactatattccctggatcgag
aacataattagtgatttttaa

DBGET integrated database retrieval system