KEGG   Homo sapiens (human): 10747Help
Entry
10747             CDS       T01001                                 

Gene name
MASP2, MAP19, MASP-2, MASP1P1, sMAP
Definition
mannan-binding lectin serine peptidase 2 (EC:3.4.21.104)
Orthology
K03993  
mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Staphylococcus aureus infection
Disease
H00105  
Mannose-binding lectin pathway component defects
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.3-p36.2
AA seq 686 aa AA seqDB search
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISDF
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgaccctcctgggccttctgtgtggctcggtggccacccccttgggcccg
aagtggcctgaacctgtgttcgggcgcctggcatcccccggctttccaggggagtatgcc
aatgaccaggagcggcgctggaccctgactgcaccccccggctaccgcctgcgcctctac
ttcacccacttcgacctggagctctcccacctctgcgagtacgacttcgtcaagctgagc
tcgggggccaaggtgctggccacgctgtgcgggcaggagagcacagacacggagcgggcc
cctggcaaggacactttctactcgctgggctccagcctggacattaccttccgctccgac
tactccaacgagaagccgttcacggggttcgaggccttctatgcagccgaggacattgac
gagtgccaggtggccccgggagaggcgcccacctgcgaccaccactgccacaaccacctg
ggcggtttctactgctcctgccgcgcaggctacgtcctgcaccgtaacaagcgcacctgc
tcagccctgtgctccggccaggtcttcacccagaggtctggggagctcagcagccctgaa
tacccacggccgtatcccaaactctccagttgcacttacagcatcagcctggaggagggg
ttcagtgtcattctggactttgtggagtccttcgatgtggagacacaccctgaaaccctg
tgtccctacgactttctcaagattcaaacagacagagaagaacatggcccattctgtggg
aagacattgccccacaggattgaaacaaaaagcaacacggtgaccatcacctttgtcaca
gatgaatcaggagaccacacaggctggaagatccactacacgagcacagcgcagccttgc
ccttatccgatggcgccacctaatggccacgtttcacctgtgcaagccaaatacatcctg
aaagacagcttctccatcttttgcgagactggctatgagcttctgcaaggtcacttgccc
ctgaaatcctttactgcagtttgtcagaaagatggatcttgggaccggccaatgcccgcg
tgcagcattgttgactgtggccctcctgatgatctacccagtggccgagtggagtacatc
acaggtcctggagtgaccacctacaaagctgtgattcagtacagctgtgaagagaccttc
tacacaatgaaagtgaatgatggtaaatatgtgtgtgaggctgatggattctggacgagc
tccaaaggagaaaaatcactcccagtctgtgagcctgtttgtggactatcagcccgcaca
acaggagggcgtatatatggagggcaaaaggcaaaacctggtgattttccttggcaagtc
ctgatattaggtggaaccacagcagcaggtgcacttttatatgacaactgggtcctaaca
gctgctcatgccgtctatgagcaaaaacatgatgcatccgccctggacattcgaatgggc
accctgaaaagactatcacctcattatacacaagcctggtctgaagctgtttttatacat
gaaggttatactcatgatgctggctttgacaatgacatagcactgattaaattgaataac
aaagttgtaatcaatagcaacatcacgcctatttgtctgccaagaaaagaagctgaatcc
tttatgaggacagatgacattggaactgcatctggatggggattaacccaaaggggtttt
cttgctagaaatctaatgtatgtcgacataccgattgttgaccatcaaaaatgtactgct
gcatatgaaaagccaccctatccaaggggaagtgtaactgctaacatgctttgtgctggc
ttagaaagtgggggcaaggacagctgcagaggtgacagcggaggggcactggtgtttcta
gatagtgaaacagagaggtggtttgtgggaggaatagtgtcctggggttccatgaattgt
ggggaagcaggtcagtatggagtctacacaaaagttattaactatattccctggatcgag
aacataattagtgatttttaa

DBGET integrated database retrieval system