KEGG   Homo sapiens (human): 1075Help
Entry
1075              CDS       T01001                                 

Gene name
CTSC, CPPI, DPP-I, DPP1, DPPI, HMS, JP, JPD, PALS, PDON1, PLS
Definition
(RefSeq) cathepsin C
  KO
K01275  cathepsin C [EC:3.4.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04210  Apoptosis
Disease
H00274  Papillon-Lefevre syndrome
H00425  Lysosomal cysteine protease deficiencies
H00696  Haim-Munk syndrome
H02050  Prepubertal periodontitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1075 (CTSC)
  Cell growth and death
   04210 Apoptosis
    1075 (CTSC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.1  dipeptidyl-peptidase I
     1075 (CTSC)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1075 (CTSC)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Papain family
   1075 (CTSC)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1075 (CTSC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 CathepsinC_exc Peptidase_C1_2 Propeptide_C1
Motif
Other DBs
NCBI-GeneID: 1075
NCBI-ProteinID: NP_001805
OMIM: 602365
HGNC: 2528
Ensembl: ENSG00000109861
Vega: OTTHUMG00000167290
Pharos: P53634(Tchem)
UniProt: P53634
Structure
PDB: 

Jmol
Position
11q14.2
AA seq 463 aa AA seqDB search
MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQ
EKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNE
TMTGWVHDVLGRNWACFTGKKVGTASENVYVNTAHLKNSQEKYSNRLYKYDHNFVKAINA
IQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNV
HGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEG
GFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALM
KLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGM
DYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgggccctccttgctgctcgccgccctcctgctgcttctctccggcgacggc
gccgtgcgctgcgacacacctgccaactgcacctatcttgacctgctgggcacctgggtc
ttccaggtgggctccagcggttcccagcgcgatgtcaactgctcggttatgggaccacaa
gaaaaaaaagtagtggtgtaccttcagaagctggatacagcatatgatgaccttggcaat
tctggccatttcaccatcatttacaaccaaggctttgagattgtgttgaatgactacaag
tggtttgccttttttaagtataaagaagagggcagcaaggtgaccacttactgcaacgag
acaatgactgggtgggtgcatgatgtgttgggccggaactgggcttgtttcaccggaaag
aaggtgggaactgcctctgagaatgtgtatgtcaacacagcacaccttaagaattctcag
gaaaagtattctaataggctctacaagtatgatcacaactttgtgaaagctatcaatgcc
attcagaagtcttggactgcaactacatacatggaatatgagactcttaccctgggagat
atgattaggagaagtggtggccacagtcgaaaaatcccaaggcccaaacctgcaccactg
actgctgaaatacagcaaaagattttgcatttgccaacatcttgggactggagaaatgtt
catggtatcaattttgtcagtcctgttcgaaaccaagcatcctgtggcagctgctactca
tttgcttctatgggtatgctagaagcgagaatccgtatactaaccaacaattctcagacc
ccaatcctaagccctcaggaggttgtgtcttgtagccagtatgctcaaggctgtgaaggc
ggcttcccataccttattgcaggaaagtacgcccaagattttgggctggtggaagaagct
tgcttcccctacacaggcactgattctccatgcaaaatgaaggaagactgctttcgttat
tactcctctgagtaccactatgtaggaggtttctatggaggctgcaatgaagccctgatg
aagcttgagttggtccatcatgggcccatggcagttgcttttgaagtatatgatgacttc
ctccactacaaaaaggggatctaccaccacactggtctaagagaccctttcaaccccttt
gagctgactaatcatgctgttctgcttgtgggctatggcactgactcagcctctgggatg
gattactggattgttaaaaacagctggggcaccggctggggtgagaatggctacttccgg
atccgcagaggaactgatgagtgtgcaattgagagcatagcagtggcagccacaccaatt
cctaaattgtag

DBGET integrated database retrieval system