KEGG   Homo sapiens (human): 1075Help
Entry
1075              CDS       T01001                                 

Gene name
CTSC, CPPI, DPP-I, DPP1, DPPI, HMS, JP, JPD, PALS, PDON1, PLS
Definition
cathepsin C (EC:3.4.14.1)
Orthology
K01275  
cathepsin C [EC:3.4.14.1]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00274  
Papillon-Lefevre syndrome
H00425  
Lysosomal cysteine protease deficiencies
H00696  
Haim-Munk syndrome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q14.2
AA seq 141 aa AA seqDB search
MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQ
EKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKDVTDFISHLFMQLG
TVGIYDLPHLRNKLAMNRRWG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgggccctccttgctgctcgccgccctcctgctgcttctctccggcgacggc
gccgtgcgctgcgacacacctgccaactgcacctatcttgacctgctgggcacctgggtc
ttccaggtgggctccagcggttcccagcgcgatgtcaactgctcggttatgggaccacaa
gaaaaaaaagtagtggtgtaccttcagaagctggatacagcatatgatgaccttggcaat
tctggccatttcaccatcatttacaaccaaggctttgagattgtgttgaatgactacaag
tggtttgccttttttaaggatgtcactgattttatcagtcatttgttcatgcagctggga
actgtggggatatatgatttgccacatctgaggaacaaactggccatgaacagacgttgg
ggctaa

DBGET integrated database retrieval system