KEGG   Homo sapiens (human): 10772Help
Entry
10772             CDS       T01001                                 

Gene name
SRSF10, FUSIP1, FUSIP2, NSSR, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR, TASR1, TASR2
Definition
(RefSeq) serine and arginine rich splicing factor 10
  KO
K12900  
FUS-interacting serine-arginine-rich protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10772 (SRSF10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10772 (SRSF10)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10772 (SRSF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75494(Tbio)
UniProt: 
Position
1p36.11
AA seq 262 aa AA seqDB search
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacctgcgtccccccaacacgtctctgttcgtcaggaacgtggccgacgac
accaggtctgaagacttgcggcgtgaatttggtcgttatggtcctatagttgatgtgtat
gttccacttgatttctacactcgccgtccaagaggatttgcttatgttcaatttgaggat
gttcgtgatgctgaagacgctttacataatttggacagaaagtggatttgtggacggcag
attgaaatacagtttgcccagggggatcgaaagacaccaaatcagatgaaagccaaggaa
gggaggaatgtgtacagttcttcacgctatgatgattatgacagatacagacgttctaga
agccgaagttatgaaaggaggagatcaagaagtcggtcttttgattacaactatagaaga
tcgtatagtcctagaaacagtagaccgactggaagaccacggcgtagcagaagccattcc
gacaatgatagattcaaacaccgaaatcgatctttttcaagatctaaatccaattcaaga
tcacggtccaagtcccagcccaagaaagaaatgaaggctaaatcacgttctaggtctgca
tctcacaccaaaactagaggcacctctaaaacagattccaaaacacattataagtctggc
tcaagatatgaaaaggaatcaaggaaaaaagaaccacctagatccaaatctcagtcaaga
tcacagtctaggtctaggtcaaaatctagatcaaggtcttggactagtcctaagtccagt
ggccactga

KEGG   Homo sapiens (human): 10929Help
Entry
10929             CDS       T01001                                 

Gene name
SRSF8, DSM-1, SFRS2B, SRP46
Definition
(RefSeq) serine and arginine rich splicing factor 8
  KO
K12891  
splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10929 (SRSF8)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    10929 (SRSF8)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10929 (SRSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BRL6(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
11q21
AA seq 282 aa AA seqDB search
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFV
RFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRS
YGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRY
RESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRS
RSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcggccgcccccctcccgacgtggacggcatgatcaccctcaaggtggacaac
ctgacctaccgcacctctcccgacagcttgaggcgcgtgttcgagaagtacgggcgcgtg
ggcgacgtgtacatcccgcgggagccccacaccaaggcgccccggggcttcgctttcgtc
cgctttcacgaccggcgcgacgcccaagacgccgaggccgccatggacggggcggagctg
gacggacgcgagctgcgggtgcaggtggcgcgctatggccgccgggacctgccccgcagc
cgccagggagagccacgcggcaggtccagaggcggcggctacggacggcggagccgcagc
tacgggcggcggagccgcagccccaggcggcgacaccgcagccgatcccggggtcccagc
tgctccaggtcccgcagccgatctcgctataggggttctcgctatagccggtctccctac
agccgatctccttacagccggtcgcgctacagccgctctccctacagcagatctcgctac
agggaatctcgctacggcggatctcactacagctcatctggttacagtaactctcgctac
agccgatatcacagcagccggtctcactcgaagtctgggtcctccactagctctcgctct
gcatcaacctccaaatcgagctctgcgcgacgatccaagtcctcctcggtctccaggtct
cgctcgcggtccaggtcttcatctatgaccaggagtcctccccgggtatccaagaggaaa
tccaagtcaaggtcgcgatccaagaggccccccaagtctcctgaagaggaaggacagatg
tcctcttaa

KEGG   Homo sapiens (human): 29896Help
Entry
29896             CDS       T01001                                 

Gene name
TRA2A, AWMS1, HSU53209
Definition
(RefSeq) transformer 2 alpha homolog
  KO
K12897  
transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    29896 (TRA2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29896 (TRA2A)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    29896 (TRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13595(Tbio)
UniProt: 
Position
7p15.3
AA seq 282 aa AA seqDB search
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtggaggaaaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcggagagcaggtcaggatctcgtagtccatca
agggtttccaaacactctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
aggagacattctcatagacgttacactcgatccagatcccactctcactctcataggaga
cgatctcgaagtagatcatatacaccagaataccggcggcgaaggagccgaagccattct
ccaatgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgc
cttggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttct
cgatatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcga
ggatttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggca
aatggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcg
cacacaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtgga
ggaggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgataga
ggatatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatca
ccttctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaaga
cgctattga

KEGG   Homo sapiens (human): 6426Help
Entry
6426              CDS       T01001                                 

Gene name
SRSF1, ASF, SF2, SF2p33, SFRS1, SRp30a
Definition
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  
splicing factor, arginine/serine-rich 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
IL-17 signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6426 (SRSF1)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    6426 (SRSF1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6426 (SRSF1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6426 (SRSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q07955(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q22
AA seq 248 aa AA seqDB search
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggaggtggtgtgattcgtggccccgcagggaacaacgattgccgcatctacgtg
ggtaacttacctccagacatccgaaccaaggacattgaggacgtgttctacaaatacggc
gctatccgcgacatcgacctcaagaatcgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagacgcggtgtatggtcgcgacggctatgattacgat
gggtaccgtctgcgggtggagtttcctcgaagcggccgtggaacaggccgaggcggcggc
gggggtggaggtggcggagctccccgaggtcgctatggccccccatccaggcggtctgaa
aacagagtggttgtctctggactgcctccaagtggaagttggcaggatttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacctatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

KEGG   Homo sapiens (human): 6427Help
Entry
6427              CDS       T01001                                 

Gene name
SRSF2, PR264, SC-35, SC35, SFRS2, SFRS2A, SRp30b
Definition
(RefSeq) serine and arginine rich splicing factor 2
  KO
K12891  
splicing factor, arginine/serine-rich 2
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Disease
H01481  
Myelodysplastic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6427 (SRSF2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6427 (SRSF2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6427 (SRSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q01130(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 221 aa AA seqDB search
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagctacggccgcccccctcccgatgtggagggtatgacctccctcaaggtggacaac
ctgacctaccgcacctcgcccgacacgctgaggcgcgtcttcgagaagtacgggcgcgtc
ggcgacgtgtacatcccgcgggaccgctacaccaaggagtcccgcggcttcgccttcgtt
cgctttcacgacaagcgcgacgctgaggacgctatggatgccatggacggggccgtgctg
gacggccgcgagctgcgggtgcaaatggcgcgctacggccgccccccggactcacaccac
agccgccggggaccgccaccccgcaggtacgggggcggtggctacggacgccggagccgc
agccctaggcggcgtcgccgcagccgatcccggagtcggagccgttccaggtctcgcagc
cgatctcgctacagccgctcgaagtctcggtcccgcactcgttctcgatctcggtcgacc
tccaagtccagatccgcacgaaggtccaagtccaagtcctcgtcggtctccagatctcgt
tcgcggtccaggtcccggtctcggtccaggagtcctcccccagtgtccaagagggaatcc
aaatccaggtcgcgatcgaagagtccccccaagtctcctgaagaggaaggagcggtgtcc
tcttaa

KEGG   Homo sapiens (human): 6428Help
Entry
6428              CDS       T01001                                 

Gene name
SRSF3, SFRS3, SRp20
Definition
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  
splicing factor, arginine/serine-rich 3
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6428 (SRSF3)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P84103(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31-p21.2
AA seq 164 aa AA seqDB search
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

KEGG   Homo sapiens (human): 6429Help
Entry
6429              CDS       T01001                                 

Gene name
SRSF4, SFRS4, SRP75
Definition
(RefSeq) serine and arginine rich splicing factor 4
  KO
K12893  
splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6429 (SRSF4)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6429 (SRSF4)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6429 (SRSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q08170(Tbio)
UniProt: 
Position
1p35.3
AA seq 494 aa AA seqDB search
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS
RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKS
RSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRS
REESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSAS
RSPSRSRSRSHSRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgggtgtacatcggccgcctgagctaccaggcccgggagcgcgatgtggagcgc
ttctttaagggctacgggaagatcctggaggtggatctgaagaacggatatggttttgtg
gagtttgatgatctgcgtgatgcagatgatgctgtttatgaactgaatggcaaagacctt
tgtggtgagcgagtaattgttgagcatgcccgcggcccacggcgagatggcagttacggt
tctggacgcagtggatatggttatagaagaagtggccgagataaatatggccctcctact
cgcacagagtacagacttattgtggagaatttgtcaagtcggtgcagctggcaagaccta
aaggattatatgcgtcaggcaggagaagtgacttatgcagatgctcacaagggacgcaaa
aatgaaggggtgattgaatttgtatcttattctgatatgaaaagagctttggaaaagttg
gatggaactgaagtcaatgggagaaaaatcagattagttgaagacaagccaggttccaga
cgacgccggtcctactccagaagccggagtcattcaaggtctcgctctcgaagcagacat
tcccgtaagagcagaagccgaagtggcagcagcaaaagcagtcattctaagagtagatct
cggtccaggtcgggctcccgctcccggagcaagagccggagccggagccagagtcggagc
cggagcaagaaagagaaaagcaggagccccagcaaggaaaagagccgcagccgcagccat
agcgctggcaagagccgcagcaagagcaaagaccaagctgaagagaagatccaaaacaat
gacaatgtcgggaaacccaagagccggagtcctagcaggcataaaagtaagagcaaaagt
cggagcaggagtcaggagaggagagtggaggaggagaagcgagggagtgtgagcaggggc
aggagccaggagaagagcctccgccagagtcggagccggagcaggagcaaagggggcagc
aggagccggagcaggagccgcagcaagagcaaggacaagaggaagggcaggaagagaagc
agagaggagagccgcagtcgcagtcgcagccgcagcaagagtgagaggagcagaaagcga
ggcagcaagcgagacagcaaggcgggcagcagcaagaagaagaagaaggaagacactgac
cgctcccagtccagatctccatcccgctccgtgtcaaaggagcgggaacatgccaagtct
gaatccagccagagggaaggtcgaggagagagtgagaatgctggcaccaatcaggagacc
cggtccaggtcgagatccaattccaaatcgaaaccaaaccttccatcagaatcacgctcc
agatcaaagtcagcttcaaaaacccgatctcggtccaagtctagatccaggtctgcttcc
agatcgccctcccgatctagatctaggtcccactcaaggtcctaa

KEGG   Homo sapiens (human): 6430Help
Entry
6430              CDS       T01001                                 

Gene name
SRSF5, HRS, SFRS5, SRP40
Definition
(RefSeq) serine and arginine rich splicing factor 5
  KO
K12893  
splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6430 (SRSF5)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6430 (SRSF5)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6430 (SRSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13243(Tbio)
UniProt: 
Position
14q24.1
AA seq 272 aa AA seqDB search
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgtcgggtattcatcgggagactaaatccagcggccagggagaaggacgtg
gaaagattcttcaagggatatggacggataagagatattgatctgaaaagaggctttggt
tttgtggaatttgaggatccaagggatgcagatgatgctgtgtatgagcttgatggaaaa
gaactctgtagtgaaagggttactattgaacatgctagggctcggtcacgaggtggaaga
ggtagaggacgatactctgaccgttttagtagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgtcttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacgtttgcggatgcacac
cgacctaaattaaatgaaggggtggttgagtttgcctcttatggtgacttaaagaatgct
attgaaaaactttctggaaaggaaataaatgggagaaaaataaaattaattgaaggcagc
aaaaggcacagtaggtcaagaagcaggtctcgatcccggaccagaagttcctctaggtct
cgtagccgatcccgttcccgtagtcgcaaatcttacagccggtcaagaagcaggagcagg
agccggagccggagcaagtcccgttctgttagtaggtctcccgtgcctgagaagagccag
aaacgtggttcttcaagtagatctaagtctccagcatctgtggatcgccagaggtcccgg
tcccgatcaaggtccagatcagttgacagtggcaattaa

KEGG   Homo sapiens (human): 6431Help
Entry
6431              CDS       T01001                                 

Gene name
SRSF6, B52, HEL-S-91, SFRS6, SRP55
Definition
(RefSeq) serine and arginine rich splicing factor 6
  KO
K12893  
splicing factor, arginine/serine-rich 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6431 (SRSF6)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6431 (SRSF6)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6431 (SRSF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13247(Tbio)
UniProt: 
Position
20q13.11
AA seq 344 aa AA seqDB search
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcgtctacataggacgcctgagctacaacgtccgggagaaggacatccagcgc
tttttcagtggctatggccgcctcctcgaagtagacctcaaaaatgggtacggcttcgtg
gagttcgaggactcccgcgacgccgacgacgccgtttacgagctgaacggcaaggagctc
tgcggcgagcgcgtgatcgtagagcacgcccggggcccgcgtcgcgatcgcgacggctac
agctacggaagccgcagtggtggaggtggatacagcagtcggagaacatctggcagagac
aaatacggaccacctgttcgtacagaatacaggcttattgtagaaaatctttctagtcgg
tgcagttggcaagatttaaaggattttatgcgacaagcaggtgaagtaacctatgcggat
gcccacaaggaacgaacaaatgagggtgtaattgagtttcgctcctactctgacatgaag
cgtgctttggacaaactggatggcacagaaataaatggcagaaatattaggcttattgaa
gataagccacgcacaagccataggcgatcttactctggaagcagatccaggtctcgatct
agaagacggtcacgaagtaggagtcgcaggagcagccgcagtagatctcgaagtatctca
aaaagtcgctcccgttccaggtcgcggagcaaaggtcgatcacgttctcgatcaaaaggc
aggaaatctagatcaaagagcaaatctaagcccaagtctgatcggggctcccattcacat
tctcgaagcagatctaaggatgagtatgagaaatctcgaagcaggtctcggtcccgatcc
cctaaagaaaatggaaagggtgatataaagtcaaaatccagatcaaggagccagtcccgt
tccaattcgccgctacctgttccaccctcaaaggcccgttctgtgtcccctccaccaaaa
agagctacttcaagatcccgttctagatctcgctcaaagtcaagatcaaggtccaggtcg
agttccagagattaa

KEGG   Homo sapiens (human): 6432Help
Entry
6432              CDS       T01001                                 

Gene name
SRSF7, 9G8, AAG3, SFRS7
Definition
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  
splicing factor, arginine/serine-rich 7
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6432 (SRSF7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16629(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p22.1
AA seq 238 aa AA seqDB search
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

KEGG   Homo sapiens (human): 6434Help
Entry
6434              CDS       T01001                                 

Gene name
TRA2B, Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Definition
(RefSeq) transformer 2 beta homolog
  KO
K12897  
transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    6434 (TRA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6434 (TRA2B)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6434 (TRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P62995(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.2
AA seq 288 aa AA seqDB search
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacagcggcgagcagaactacggcgagcgggaatcccgttctgcttccagaagt
ggaagtgctcacggatcggggaaatctgcaaggcatacccctgcaaggtctcgctccaag
gaagattccaggcgttccagatcaaagtccaggtcccgatctgaatctaggtctagatcc
agaagaagctcccgaaggcattatacccggtcacggtctcgctcccgctcccatagacga
tcacgtagcaggtcttacagtcgagattatcgtagacggcacagccacagccattctccc
atgtctactcgcaggcgtcatgttgggaatcgggcaaatcctgatcctaactgttgtctt
ggagtatttgggctgagcttgtacaccacagaaagagatctaagagaagtgttctctaaa
tatggtcccattgccgatgtgtctattgtatatgaccagcagtctaggcgttcaagagga
tttgcctttgtatattttgaaaatgtagatgatgccaaggaagctaaagaacgtgccaat
ggaatggagcttgatgggcgtaggatcagagttgatttctctataacaaaaagaccacat
acgccaacaccaggaatttacatggggagacctacctatggcagctctcgccgtcgggat
tactatgacagaggatatgatcggggctatgatgatcgggactactatagcagatcatac
agaggaggaggtggaggaggaggaggatggagagctgcccaagacagggatcagatttat
agaaggcggtcaccttctccttactatagtcgtggaggatacagatcacgttccagatct
cgatcatactcacctcgtcgctattaa

KEGG   Homo sapiens (human): 8683Help
Entry
8683              CDS       T01001                                 

Gene name
SRSF9, SFRS9, SRp30c
Definition
(RefSeq) serine and arginine rich splicing factor 9
  KO
K21123  
splicing factor, arginine/serine-rich 9
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    8683 (SRSF9)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8683 (SRSF9)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    8683 (SRSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13242(Tbio)
UniProt: 
Position
12q24.31
AA seq 221 aa AA seqDB search
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtggggaac
cttccgaccgacgtgcgcgagaaggacttggaggacctgttctacaagtacggccgcatc
cgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttcgag
gacccccgagatgcagaggatgctatttatggaagaaatggttatgattatggccagtgt
cggcttcgtgtggagttccccaggacttatggaggtcggggtgggtggccccgtggtggg
aggaatgggcctcctacaagaagatctgatttccgagttcttgtttcaggacttcctccg
tcaggcagctggcaggacctgaaggatcacatgcgagaagctggggatgtctgttatgct
gatgtgcagaaggatggagtggggatggtcgagtatctcagaaaagaagacatggaatat
gccctgcgtaaactggatgacaccaaattccgctctcatgagggtgaaacttcctacatc
cgagtttatcctgagagaagcaccagctatggctactcacggtctcggtctgggtcaagg
ggccgtgactctccataccaaagcaggggttccccacactacttctctcctttcaggccc
tactga

DBGET integrated database retrieval system