KEGG   Homo sapiens (human): 10776Help
Entry
10776             CDS       T01001                                 

Gene name
ARPP19, ARPP-16, ARPP-19, ARPP16, ENSAL
Definition
(RefSeq) cAMP regulated phosphoprotein 19
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.2
AA seq 112 aa AA seqDB search
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggaagtccccgaggcagcctccgcggaggagcagaaggaaatggaagataaa
gtgactagtccagagaaagcagaagaagcaaaattaaaagcaagatatcctcatctggga
caaaagcctggaggttcagatttcttaaggaaacggttgcagaaagggcaaaaatatttt
gattctggggattacaacatggctaaagcaaaaatgaagaacaagcaacttcctactgca
gctccggataagacggaggtcactggtgaccacattcccactccgcaagaccttcctcaa
cggaagccgtcccttgttgctagcaagctggctggctga

DBGET integrated database retrieval system