KEGG   Homo sapiens (human): 10782Help
Entry
10782             CDS       T01001                                 

Gene name
ZNF274, HFB101, ZF2, ZKSCAN19, ZSCAN51
Definition
(RefSeq) zinc finger protein 274
  KO
K12458  
zinc finger protein 274
Organism
hsa  Homo sapiens (human)
Pathway
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    10782 (ZNF274)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    10782 (ZNF274)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96GC6(Tbio)
UniProt: 
Position
19q13.43
AA seq 653 aa AA seqDB search
MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNLVSVEHQLSKP
DVVSQLEEAEDFWPVERGIPQDTIPEYPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEV
AGPRNAQIQALYAEDGSLSADAPSEQVQQQGKHPGDPEAARQRFRQFRYKDMTGPREALD
QLRELCHQWLQPKARSKEQILELLVLEQFLGALPVKLRTWVESQHPENCQEVVALVEGVT
WMSEEEVLPAGQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLPEEPVTFQDVAVDFSREE
WGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPEEEPAPSLKVQESSRD
CALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHFDNRESQANSGALDTNQVSLQ
KIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKE
GNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDC
GKGFVQSSSLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAF
RQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaggcttccgacggcctggtcctgtgaaccagtgacctttgaagatgtaaca
ctgggttttaccccggaagagtggggactgctggacctcaaacagaagtccctgtacagg
gaagtgatgctggagaactacaggaacctggtctcagtggaacatcagctttccaaacca
gatgtggtatctcagttagaggaggcagaagatttctggccagtggagagaggaattcct
caagacaccattccagagtatcctgagctccagctggaccctaaattggatcctcttcct
gctgagagtcccctaatgaacattgaggttgttgaggtcctcacactgaaccaggaggtg
gctggtccccggaatgcccagatccaggccctatatgctgaagatggaagcctgagtgca
gatgcccccagtgagcaggtccaacagcagggcaagcatccaggtgaccctgaggccgcg
cgccagaggttccggcagttccgttataaggacatgacaggtccccgggaggccctggac
cagctccgagagctgtgtcaccagtggctacagcctaaggcacgctccaaggagcagatc
ctggagctgctggtgctggagcagttcctaggtgcactgcctgtgaagctccggacatgg
gtggaatcgcagcacccagagaactgccaagaggtggtggccctggtagagggtgtgacc
tggatgtctgaggaggaagtacttcctgcaggacaacctgccgagggcaccacctgctgc
ctcgaggtcactgcccagcaggaggagaagcaggaggatgcagccatctgcccagtgaca
gtgctccctgaggagccagtgaccttccaggatgtggctgtggacttcagccgggaggag
tgggggctgctgggcccgacacagaggaccgagtaccgcgatgtgatgctggagaccttt
gggcacctggtctctgtggggtgggagactacactggaaaataaagagttagctccaaat
tctgacattcctgaggaagaaccagcccccagcctgaaagtacaagaatcctcaagggat
tgtgccttgtcctctacattagaagataccttgcagggtggggtccaggaagtccaagac
acagtgttgaagcagatggagtctgctcaggaaaaagaccttcctcagaagaagcacttt
gacaaccgtgagtcccaggcaaacagtggtgctcttgacacaaaccaagtttcgctccag
aaaattgacaaccctgagtcccaggcaaacagtggcgctcttgacacaaaccaagttttg
ctccacaaaattcctcctagaaaacgattgcgcaaacgtgactcacaagttaaaagtatg
aaacataattcacgtgtaaaaattcatcagaagagctgtgaaaggcaaaaggccaaggaa
ggcaatggttgtaggaaaaccttcagtcggagtactaaacagattacgtttataagaatt
cacaaggggagccaagtttgccgatgcagtgaatgtggtaaaatattccggaacccaaga
tacttttctgtgcataagaaaatccataccggagagaggccctatgtgtgtcaagactgt
gggaaaggatttgttcagagctcttccctcacacagcatcagagagttcattctggagag
agaccatttgaatgtcaggagtgtgggaggaccttcaatgatcgctcagccatctcccag
cacctgaggactcacactggcgctaagccctacaagtgtcaggactgtggaaaagccttc
cgccagagctcccacctcatcagacatcagaggactcacaccggggagcgcccatatgca
tgcaacaaatgtggaaaggccttcacccagagctcacaccttattgggcaccagagaacc
cacaataggacaaagcgaaagaagaaacagcctacctcatag

DBGET integrated database retrieval system