KEGG   Homo sapiens (human): 10783Help
Entry
10783             CDS       T01001                                 

Gene name
NEK6, SID6-1512
Definition
(RefSeq) NIMA related kinase 6 (EC:2.7.11.1)
  KO
K08857  
NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10783 (NEK6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NEK family
   10783 (NEK6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10783 (NEK6)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    10783 (NEK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3-q34.11
AA seq 313 aa AA seqDB search
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
QVAKQMHIWMSST
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacacc
ctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgc
tcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtac
aaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgag
atgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactg
aaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacatt
gtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcag
aagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtg
gagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatc
acagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgag
accaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccat
gagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatg
gcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaag
atcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaa
ctggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcac
caggtggccaagcagatgcacatctggatgtccagcacctga

DBGET integrated database retrieval system