KEGG   Homo sapiens (human): 10788Help
Entry
10788             CDS       T01001                                 

Gene name
IQGAP2
Definition
IQ motif containing GTPase activating protein 2
Orthology
K05767  
Ras GTPase-activating-like protein IQGAP2/3
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10788 (IQGAP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10788 (IQGAP2)
  Exosomal proteins of colorectal cancer cells
   10788 (IQGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q13.3
AA seq 1525 aa AA seqDB search
MEVCLVEELPPTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHT
DNTVQWLRAMESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLG
KVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAVEKGIA
EQTVVTLRNPNAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEEERDAYEELLT
QAEIQGNINKVNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFN
LQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVE
RYANTLLSVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPL
RTLETLLLPTANISDVDPAHAQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANV
DEDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELK
SERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLYKESWLTGKEIEDIIEEVTVG
YIRENIWSASEELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAFWKGYKQRKEY
MHRRQTFIDNTDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDY
KTLVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDI
KIGLLVKNRITLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFY
LLQTNPLYLAKLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSK
VDQVQDIVTGNPTVIKMVVSFNRGARGQNTLRQLLAPVVKEIIDDKSLIINTNPVEVYKA
WVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEASIENLRRVTDKVLNSIISSLDLLP
YGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQI
NSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEE
KFNMDKYTDLVTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTV
ESFLGEGAVDPNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDV
IRNQPGNTLTEILETPATAQQEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQK
KRKIQRNLRTLEQTGHVSSENKYQDILNEIAKDIRNQRIYRKLRKAELAKLQQTLNALNK
KAAFYEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGKGEPKGAKRAKPVKYTAAKLHEKG
VLLDIDDLQTNQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAV
MKMFDKVKVNVNLLIYLLNKKFYGK
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttgcttagttgaagaattgccaccaaccactgaattggaagaagggctccgg
aatggagtttaccttgcaaagttagccaagttctttgccccgaaaatggtatcagagaaa
aagatctatgatgtggaacaaacacgttataagaagtctggccttcattttcgacacaca
gataataccgtccagtggttaagagcgatggagtctattggtctacccaagatattttat
ccagaaacaacagatgtctatgatcggaaaaacataccaagaatgatatattgcattcac
gcactgagtttgtatctgttcaaactaggaatagcaccccagatccaggatttgttgggc
aaagtagacttcacagaggaggaaatcagtaatatgagaaaagaacttgagaaatatgga
atacagatgccatctttcagcaaaataggtggtattctggccaatgaactgtccgtggat
gaagctgcattacatgctgcagttatagccattaatgaagcagttgaaaaaggaatagca
gagcaaaccgttgtaacactaagaaacccaaatgcggttttaactttagtggatgacaac
cttgcaccagaatatcagaaagaactctgggatgccaaaaagaaaaaagaggaaaatgca
agactgaagaatagctgtatttcagaagaagaaagagatgcttatgaagaactgctgaca
caagcagaaatccaaggcaatattaataaagtcaacaggcaggctgcagtggaccatatc
aatgctgtcattccggaaggtgaccccgagaatacgctgcttgcactgaagaaaccagag
gcccagctgcctgctgtttatccctttgctgctgccatgtatcagaacgaacttttcaac
ctccagaaacagaacaccatgaactacttggcccacgaggagcttttgattgctgtggaa
atgttgtctgctgttgctttactaaaccaggccttggaaagcaacgatcttgtgtctgtg
cagaatcaactcagaagccccgcaataggcttaaacaatctggacaaggcatatgtggaa
cgttatgcaaacacactactctctgttaaactagaagttttatcccaagggcaagataac
ttaagctggaatgaaattcagaattgtattgatatggttaatgctcaaattcaagaagaa
aatgaccgagttgtagctgtagggtacatcaatgaagctattgatgaagggaatcctttg
aggactttagaaactttgctcctacctactgcgaatattagtgatgtggacccagcccat
gcccagcactaccaggatgttttataccatgctaaatcacagaaactcggagactctgag
agtgtttccaaagtgctttggctggatgagatacagcaagccgtcgatgatgccaacgtg
gacgaggacagagcaaaacaatgggttactctggtggttgatgttaatcagtgtttggaa
ggaaaaaaatcaagtgatattttgtctgtattgaagtcttccacttctaatgcaaatgac
ataatcccggagtgtgctgacaaatactatgatgcccttgtgaaggcaaaagagctcaaa
tctgaaagagtgtctagtgacggttcatggctcaaactcaacctgcacaaaaaatatgac
tactattacaacactgattcaaaagagagttcctgggtcacacctgaatcatgcttgtat
aaagaatcatggctcacaggaaaagaaatcgaggacattattgaggaagtcacagtaggt
tacattcgtgagaatatatggtctgcttcagaagagttgcttcttcgctttcaagccaca
agctcaggacccatccttagggaagagtttgaagctagaaaatcatttttgcatgaacaa
gaagagaatgtggtcaaaatacaggctttttggaaaggatataaacaacggaaggagtat
atgcacaggcggcaaacgttcattgataatactgattctattgtgaagattcagtcctgg
ttccgaatggcaactgcaagaaagagctatctttcaagactacagtatttcagagatcat
aataatgaaattgtgaaaatacagtcactgttgagagcgaacaaagctagagatgactac
aaaacattggttggctctgaaaacccaccattaacagtaattcgcaaatttgtatacctg
ctggaccaaagtgatttggatttccaggaggaactagaggttgcacgattaagggaagaa
gtagtgaccaagatcagggccaatcaacagctggaaaaagacctgaacctgatggacatc
aagattggactgctggtgaagaacaggatcacactagaggatgtaatttcacacagtaaa
aagctgaacaagaaaaaaggaggagaaatggaaatactgaataacaccgacaaccaagga
ataaaaagtttgagtaaggagaggagaaaaacactagaaacatatcagcagctgttttac
cttttacagaccaaccctttatacttggctaagctgattttccagatgccacagaacaag
tccactaaatttatggatactgttattttcacactatataattatgcctctaatcagcga
gaagaatatctacttctcaagctttttaaaactgctctggaggaagaaataaaatcaaaa
gtggaccaggtacaggacatagttactggtaaccctacagtcatcaagatggtcgtcagc
ttcaatagaggtgcccggggacagaacaccctgcgccaactcctggctccagtggtaaaa
gagatcatcgacgacaagtcgctgattatcaacacaaaccctgtagaggtgtacaaggct
tgggtgaaccaactagaaacacagactggagaggccagcaagttgccttatgatgtgacc
acagaacaagctctaacatacccagaagtgaaaaataaactggaggcttccattgagaac
ctgagaagggtcaccgacaaagtcctgaattctatcatttcttcccttgatctactgcct
tatggattgaggtatatagccaaagtactgaagaattcgatccatgagaaattccccgat
gcaacagaagatgagctattaaagattgttggaaacctcctgtactatcggtacatgaat
ccagccattgtagctccagatggctttgatatcatcgacatgacagctggaggtcagata
aattctgaccaaaggagaaacttaggatcagtggccaaggttcttcagcacgcagcctcc
aacaagctgtttgaaggagaaaatgagcatctctcatctatgaacaattatttatcagag
acgtatcaggaattcaggaaatatttcaaagaagcatgtaatgtccctgagccagaagag
aagtttaatatggacaaatacacagacctggtgacagtcagcaaaccagtcatttatatt
tcaattgaagaaatcatcagcacacactcactcctgttggaacaccaggatgcaattgcc
cctgagaaaaatgacttactgagtgaattgctggggtcgctgggagaggtgccaaccgtg
gaatcttttcttggggaaggagcagttgaccccaatgaccctaacaaggcaaatacacta
agtcagctttcaaagaccgagatttctcttgtcttgacaagcaaatatgacatagaggac
ggtgaagctatagatagccgaagcctcatgataaagaccaagaagctgataattgatgtg
atccggaaccagccagggaacacattgacagaaatcttagagacaccagcaactgcgcaa
caggaggtagaccatgccacggacatggtgagccgtgcaatgatagattccaggactcca
gaagaaatgaagcatagccaatctatgattgaagatgcacagctgcctcttgagcagaag
aagaggaaaatccagaggaatcttcggacgttggaacagactggacacgtgtcatccgaa
aataaataccaagacattctcaatgagattgccaaggatattcgaaatcaaagaatctat
cgtaagcttcgaaaagctgaattggcaaaacttcagcagaccctgaatgcacttaacaag
aaggcagcattttatgaagagcaaatcaattattatgacacctacataaagacttgttta
gacaacttaaaaagaaaaaatactcggagatcaattaaactagatggaaaaggagaaccc
aaaggggcgaagagagcgaagccagtgaagtacactgcagcaaagctgcatgagaaaggt
gtcctgctagatatagatgatcttcaaacaaaccagtttaagaatgttacatttgatatc
atagctactgaagatgtaggcattttcgatgtaagatcaaaattccttggtgttgagatg
gaaaaggtgcaactcaatattcaggatttacttcagatgcaatatgaaggagtagctgta
atgaaaatgtttgataaggttaaagtgaatgtaaaccttctcatatacctgctgaacaag
aagttctatggaaagtga

DBGET integrated database retrieval system