KEGG   Homo sapiens (human): 10791Help
Entry
10791             CDS       T01001                                 

Gene name
VAMP5
Definition
vesicle-associated membrane protein 5
Orthology
K08514  
vesicle-associated membrane protein 5
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p11.2
AA seq 116 aa AA seqDB search
MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQ
KKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatagagttggagcggtgccagcagcaggcgaacgaggtgacggaaattatg
cgtaacaacttcggcaaggtcctggagcgtggtgtgaagctggccgaactgcagcagcgt
tcagaccaactcctggatatgagctcaaccttcaacaagactacacagaacctggcccag
aagaagtgctgggagaacatccgttaccggatctgcgtggggctggtggtggttggtgtc
ctgctcatcatcctgattgtgctgctggtcgtctttctccctcagagcagtgacagcagt
agtgccccacggacccaggatgcaggcattgcctcagggcctgggaactga

DBGET integrated database retrieval system