KEGG   Homo sapiens (human): 10795Help
Entry
10795             CDS       T01001                                 

Gene name
ZNF268, HZF3
Definition
(RefSeq) zinc finger protein 268
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    10795 (ZNF268)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 C1_4 zf-C2H2_jaz CpXC DUF3268 zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 10795
NCBI-ProteinID: NP_001159353
OMIM: 604753
HGNC: 13061
Ensembl: ENSG00000090612
Vega: OTTHUMG00000167946
Pharos: Q14587(Tbio)
UniProt: Q14587 Q2TB61
Structure
PDB: 

Jmol
Position
12q24.33
AA seq 947 aa AA seqDB search
MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEK
VLEWLFISQEQPKITKSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL
GYQHTKPDIIFKLEQGEELCMVQAQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFE
CTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHE
QTVIGIKYCESIESGKTVNKKSQLMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAE
EKPYGCNECGKDFSSKSYLIVHQRIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPY
ECCECGKVFSRKDQLVSHQKTHSGQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNE
CQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKG
FSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFK
SQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLI
IHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKG
VHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTG
EKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPY
GCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQ
CEKSFSGKLRLLVHQRMHTREKPYECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKT
FSQKSILSAHQRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagggtccggacagcttctatttgggtcccacctctccaagaacgaaacagt
tcatgggataggatcagaaagctccaaggtcaggaatccatcttgggccaagggactcct
ggtctgcaacctctccctggaacacccaggcagaagcagaagagtcgcagaatagagaaa
gtcctagagtggctgtttatttcccaagagcagccaaaaatcaccaagtcctggggacct
ttgtcattcatggatgtgtttgtggattttacctgggaggagtggcagctgctagaccca
gcacagaagtgcctgtacaggagtgtgatgttggagaactatagcaacctggtgtcccta
gggtaccaacacaccaaacctgatatcatcttcaagttggaacaaggagaagagctgtgt
atggtgcaggcccaagttccaaatcagacctgtccaaacacagtctggaaaattgatgat
cttatggattggcatcaggaaaataaagacaagctgggaagtacggcaaaaagctttgaa
tgcactacatttggaaaactatgtcttcttagtacaaagtatctttcaagacaaaaacct
cataaatgtggcacgcatggaaagagtttgaaatatatagatttcactagtgattatgct
agaaataatcctaatgggtttcaggtacatggaaaatcattcttccattctaaacatgag
caaactgttattggaataaaatactgtgaaagtattgaatctggaaaaaccgtcaataag
aaatcgcaacttatgtgccaacaaatgtatatgggcgaaaaaccctttggatgcagctgt
tgtgagaaagccttcagcagcaagtcataccttctagtgcatcagcaaactcatgccgaa
gagaaaccctatggttgtaatgaatgtgggaaagacttcagtagtaaatcatacctcatt
gtacatcagagaattcatacaggagagaaactacatgaatgcagtgaatgcaggaaaaca
ttcagtttccattcacagcttgttatacatcagagaattcacacaggtgagaatccctat
gagtgctgtgaatgtgggaaagtcttcagtaggaaagaccagcttgtttcacaccagaaa
actcattcaggacagaaaccatatgtgtgtaatgaatgtgggaaagcttttggtttaaaa
tcacagctcattatacatgaaagaattcatacaggagagaaaccatatgaatgcaatgaa
tgtcagaaagcctttaatacaaagtcaaaccttatggtacatcagagaacccatacaggg
gagaaaccttatgtttgtagtgattgtggaaaagcctttacattcaagtcacagctcatt
gtacatcaggggattcacacaggagtaaagccctatgggtgtattcagtgtggtaaagga
ttcagtttgaaatcacagctcattgtacatcagagaagtcacacaggaatgaaaccttat
gtatgcaatgaatgtggcaaagccttcaggagcaagtcataccttattatacatacaagg
actcatacaggagaaaaactccatgaatgcaacaattgtgggaaagccttcagttttaaa
tcacagctcattatacatcagaggattcatacaggagagaacccctatgaatgccatgaa
tgtgggaaagccttcagtcggaaataccagcttatttcacaccagagaactcatgcagga
gagaagccttatgaatgcaccgactgtggaaaggcttttggtttaaagtcacagcttatt
atacaccagagaactcatacaggggagaaaccatttgaatgtagtgagtgtcagaaagcc
tttaatacaaagtcaaacctgattgtacatcagagaactcatacaggagagaaaccctat
agttgtaatgaatgtggaaaagcctttacgttcaaatcacagctcattgtacataaagga
gtgcacactggagtaaaaccctatggatgcagtcaatgtgcaaaaacctttagtttgaag
tcccagctcattgtacatcagagaagtcacacaggagtaaaaccatatggatgcagtgag
tgtgggaaagccttcaggagcaagtcataccttattatacatatgagaactcatacagga
gagaaaccacatgagtgcagggaatgcgggaaatcctttagtttcaattcacaactcatt
gtgcatcagagaattcacacaggagaaaatccctatgaatgcagtgaatgtgggaaagcc
tttaataggaaagaccagctcatttcacatcagcgaactcatgcaggggaaaagccttat
gggtgcagtgaatgtgggaaagcttttagcagcaagtcatacctaattatacacatgaga
actcattcaggtgaaaaaccatatgaatgtaatgaatgtgggaaagccttcatttggaaa
tcactactcattgtacatgagcgaactcatgcaggggtcaacccttataaatgcagtcaa
tgtgagaaatccttcagtgggaaattacgccttcttgtacaccagagaatgcacacaaga
gagaaaccatatgaatgcagtgagtgtggaaaagccttcattaggaattctcaactcatt
gtacatcaaagaactcattcaggagagaaaccctatgggtgcaatgaatgtgggaaaacc
ttctctcaaaaatcaattctcagtgcacatcagagaacacatacaggagagaagccttgt
aagtgcactgaatgtgggaaagccttttgttggaagtcacagctcattatgcatcagaga
actcatgtagatgacaaacattga

DBGET integrated database retrieval system