KEGG   Homo sapiens (human): 10795Help
Entry
10795             CDS       T01001                                 

Gene name
ZNF268, HZF3
Definition
zinc finger protein 268
Orthology
K09228  
KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    10795 (ZNF268)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.33
AA seq 947 aa AA seqDB search
MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEK
VLEWLFISQEQPKITKSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL
GYQHTKPDIIFKLEQGEELCMVQAQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFE
CTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHE
QTVIGIKYCESIESGKTVNKKSQLMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAE
EKPYGCNECGKDFSSKSYLIVHQRIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPY
ECCECGKVFSRKDQLVSHQKTHSGQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNE
CQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKG
FSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFK
SQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLI
IHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKG
VHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTG
EKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPY
GCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQ
CEKSFSGKLRLLVHQRMHTREKPYECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKT
FSQKSILSAHQRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagggtccggacagcttctatttgggtcccacctctccaagaacgaaacagt
tcatgggataggatcagaaagctccaaggtcaggaatccatcttgggccaagggactcct
ggtctgcaacctctccctggaacacccaggcagaagcagaagagtcgcagaatagagaaa
gtcctagagtggctgtttatttcccaagagcagccaaaaatcaccaagtcctggggacct
ttgtcattcatggatgtgtttgtggattttacctgggaggagtggcagctgctagaccca
gcacagaagtgcctgtacaggagtgtgatgttggagaactatagcaacctggtgtcccta
gggtaccaacacaccaaacctgatatcatcttcaagttggaacaaggagaagagctgtgt
atggtgcaggcccaagttccaaatcagacctgtccaaacacagtctggaaaattgatgat
cttatggattggcatcaggaaaataaagacaagctgggaagtacggcaaaaagctttgaa
tgcactacatttggaaaactatgtcttcttagtacaaagtatctttcaagacaaaaacct
cataaatgtggcacgcatggaaagagtttgaaatatatagatttcactagtgattatgct
agaaataatcctaatgggtttcaggtacatggaaaatcattcttccattctaaacatgag
caaactgttattggaataaaatactgtgaaagtattgaatctggaaaaaccgtcaataag
aaatcgcaacttatgtgccaacaaatgtatatgggcgaaaaaccctttggatgcagctgt
tgtgagaaagccttcagcagcaagtcataccttctagtgcatcagcaaactcatgccgaa
gagaaaccctatggttgtaatgaatgtgggaaagacttcagtagtaaatcatacctcatt
gtacatcagagaattcatacaggagagaaactacatgaatgcagtgaatgcaggaaaaca
ttcagtttccattcacagcttgttatacatcagagaattcacacaggtgagaatccctat
gagtgctgtgaatgtgggaaagtcttcagtaggaaagaccagcttgtttcacaccagaaa
actcattcaggacagaaaccatatgtgtgtaatgaatgtgggaaagcttttggtttaaaa
tcacagctcattatacatgaaagaattcatacaggagagaaaccatatgaatgcaatgaa
tgtcagaaagcctttaatacaaagtcaaaccttatggtacatcagagaacccatacaggg
gagaaaccttatgtttgtagtgattgtggaaaagcctttacattcaagtcacagctcatt
gtacatcaggggattcacacaggagtaaagccctatgggtgtattcagtgtggtaaagga
ttcagtttgaaatcacagctcattgtacatcagagaagtcacacaggaatgaaaccttat
gtatgcaatgaatgtggcaaagccttcaggagcaagtcataccttattatacatacaagg
actcatacaggagaaaaactccatgaatgcaacaattgtgggaaagccttcagttttaaa
tcacagctcattatacatcagaggattcatacaggagagaacccctatgaatgccatgaa
tgtgggaaagccttcagtcggaaataccagcttatttcacaccagagaactcatgcagga
gagaagccttatgaatgcaccgactgtggaaaggcttttggtttaaagtcacagcttatt
atacaccagagaactcatacaggggagaaaccatttgaatgtagtgagtgtcagaaagcc
tttaatacaaagtcaaacctgattgtacatcagagaactcatacaggagagaaaccctat
agttgtaatgaatgtggaaaagcctttacgttcaaatcacagctcattgtacataaagga
gtgcacactggagtaaaaccctatggatgcagtcaatgtgcaaaaacctttagtttgaag
tcccagctcattgtacatcagagaagtcacacaggagtaaaaccatatggatgcagtgag
tgtgggaaagccttcaggagcaagtcataccttattatacatatgagaactcatacagga
gagaaaccacatgagtgcagggaatgcgggaaatcctttagtttcaattcacaactcatt
gtgcatcagagaattcacacaggagaaaatccctatgaatgcagtgaatgtgggaaagcc
tttaataggaaagaccagctcatttcacatcagcgaactcatgcaggggaaaagccttat
gggtgcagtgaatgtgggaaagcttttagcagcaagtcatacctaattatacacatgaga
actcattcaggtgaaaaaccatatgaatgtaatgaatgtgggaaagccttcatttggaaa
tcactactcattgtacatgagcgaactcatgcaggggtcaacccttataaatgcagtcaa
tgtgagaaatccttcagtgggaaattacgccttcttgtacaccagagaatgcacacaaga
gagaaaccatatgaatgcagtgagtgtggaaaagccttcattaggaattctcaactcatt
gtacatcaaagaactcattcaggagagaaaccctatgggtgcaatgaatgtgggaaaacc
ttctctcaaaaatcaattctcagtgcacatcagagaacacatacaggagagaagccttgt
aagtgcactgaatgtgggaaagccttttgttggaagtcacagctcattatgcatcagaga
actcatgtagatgacaaacattga

DBGET integrated database retrieval system