KEGG   Homo sapiens (human): 10798Help
Entry
10798             CDS       T01001                                 

Gene name
OR5I1, HSOlf1, OLF1
Definition
(RefSeq) olfactory receptor family 5 subfamily I member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    10798 (OR5I1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    10798 (OR5I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 ECSCR
Motif
Other DBs
NCBI-GeneID: 10798
NCBI-ProteinID: NP_006628
OMIM: 608496
HGNC: 8347
Ensembl: ENSG00000167825
Vega: OTTHUMG00000166821
Pharos: Q13606(Tdark)
UniProt: Q13606 A0A126GVE5
Position
11q12.1
AA seq 314 aa AA seqDB search
MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTP
MYFFLSNLSFVDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAM
AYDRYVAICNPLLYTVVMSRGICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFF
CDLPPLLKLSCTDTTINEWLLSTYGSSVEIICFIIIIISYFFILLSVLKIRSFSGRKKTF
STCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFYTIFIPVLNPLIYSLRNKDVK
DAAEKVLRSKVDSS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaatttacagatagaaactacacgttggtcactgagtttattctattaggttttcca
actcgccctgaactgcagattgtcctgttcctcatgtttctgacattgtatgctataatt
ctgatagggaacattggattgatgctgttgatcaggattgatcctcaccttcaaaccccc
atgtattttttccttagcaacctatcatttgtagacctttgctatttctcagacattgtt
cccaaaatgctggtcaatttcctctcggagaacaaatctatttcctattatgggtgtgcc
ctgcagttttattttttctgtacttttgcagatacagaatccttcatcctggccgccatg
gcctatgatcgctatgtcgccatctgtaaccctttattgtacacagttgtgatgtctagg
ggcatctgtatgcggttgattgtcttgtcataccttggaggcaacatgagttccctggtt
cacacatcctttgcctttattctgaaatattgtgacaaaaatgttattaatcattttttc
tgtgacctccctcccctgcttaaactatcctgcactgacacaacaattaatgagtggctc
ctctccacatacggcagctcagtggaaatcatttgttttatcatcatcatcatctcctac
tttttcattcttctctcagtcttaaagatccgctctttcagtgggaggaagaagaccttt
tctacatgcgcctctcacctgacttcagtgacgatctaccaagggactctcctctttatt
tactcacggcccagctacctgtattctccaaacactgataaaattatctcagtgttctac
accattttcattccagtgctgaatccgttgatttatagtttgagaaataaagatgtaaag
gatgcagctgagaaagttctaagatcaaaggtagattcttcatga

DBGET integrated database retrieval system