KEGG   Homo sapiens (human): 10799Help
Entry
10799             CDS       T01001                                 

Gene name
RPP40, RNASEP1, bA428J1.3
Definition
ribonuclease P/MRP 40kDa subunit (EC:3.1.26.5)
Orthology
K14530  
ribonucleases P/MRP protein subunit RPP40 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10799 (RPP40)
   03008 Ribosome biogenesis in eukaryotes
    10799 (RPP40)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     10799 (RPP40)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     10799 (RPP40)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    10799 (RPP40)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    10799 (RPP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p25.1
AA seq 340 aa AA seqDB search
MATLRRLREAPRHLLVCEKSNFGNHKSRHRHLVQTHYYNYRVSFLIPECGILSEELKNLV
MNTGPYYFVKNLPLHELITPEFISTFIKKGKLILSLDKDTYEETGLQGHPSQFSGRKIMK
FIVSIDLMELSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQ
EHQPKVALSTLRDLQCPVLQSSELEGTPEVSCRALELFDWLGAVFSNVDLNNEPNNFIST
YCCPEPSTVVAKAYLCTITGFILPEKICLLLEHLCHYFDEPKLAPWVTLSVQGFADSPVS
WEKNEHGFRKGGEHLYNFVIFNNQDYWLQMAVGANDHCPP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgcgccggcttcgggaggcgccgcggcacttactggtttgcgagaaatcc
aacttcggcaaccacaagtcgcgccaccggcatcttgtgcagacgcactactataactac
agggtttcatttctcattcctgaatgtgggatactatcggaagaactgaaaaacctggtc
atgaacactggaccctattactttgtgaagaatttacctcttcatgaattaattacacct
gaattcatcagtacctttataaagaaagggaaattaattttgtcactggataaagacact
tatgaagaaactggacttcagggtcatccatctcagttttctggcagaaaaattatgaaa
tttattgtttccattgatttgatggaattatccttaaacttggattctaagaagtatgaa
agaatatcttggtctttcaaagaaaagaagccattgaaatttgattttcttttggcttgg
cataaaacaggttcagaagaatcgacaatgatgtcatatttttccaagtaccaaattcag
gagcatcagccaaaagtagcactgagcacgttgagagatctccagtgcccagtgctgcag
agcagcgagctggagggaacgccagaggtgtcctgccgggctctggagctcttcgactgg
ctcggcgccgtcttcagtaatgtcgacctaaataatgagcctaataatttcatatcaacc
tattgctgtcctgagccaagcacagtggtggcaaaagcttatttgtgtacaatcactggc
ttcatacttccagagaagatctgtctcctattggaacatctctgtcactactttgatgaa
ccgaagttagctccatgggttacactgtccgttcaaggctttgcagacagccctgtttct
tgggaaaaaaatgaacatggttttcgaaaaggaggagaacatttatataactttgtgatt
tttaataatcaggactattggcttcagatggctgttggggcaaatgatcactgtccacca
taa

DBGET integrated database retrieval system