KEGG   Homo sapiens (human): 10802Help
Entry
10802             CDS       T01001                                 

Gene name
SEC24A
Definition
SEC24 family member A
Orthology
K14007  
protein transport protein SEC24
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31.1
AA seq 613 aa AA seqDB search
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKESVIGVSS
EETLITCLEIAMR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccgggaataccggcctccggcggcgccccagccagcctccaggcccagaac
ggagccgccttggcctcggggtctccctacaccaacggtcctgtccaaaatgcattgctg
tcttcacaagagtcagtgagccaaggatacaatttccagcttccaggatcctaccctcat
ccaataccagcaaagactttgaatccagtctctggacagtctaactatggtggttctcag
ggatctgggcagactcttaatagaccacctgtggcctctaatccagtgacaccttcgctt
catagtggtcctgctccccgaatgccattacctgcttctcagaacccagctactacacca
atgccttctagtagctttcttcctgaagccaacctgccaccacctttgaattggcaatat
aactatccatccacagcctcacaaacaaaccattgtcctcgtgcatcatcccaaccaact
gtatctggaaatacaagtttaaccacaaatcatcaatatgtttcttctggatatccttca
cttcaaaatagcttcataaagtcaggtccttctgtacctcccttagtgaatccacctctg
cctacaacttttcaaccaggagctcctcatgggccccctccagctggaggcccaccccca
gtgagggccctcacgcccctgacatcatcatatagagatgtaccccagcccttatttaat
tcagctgtcaaccaagaaggtattacatcaaataccaataacggatctatggtggtccac
agtagttacgacgagattgaaggaggtggcttattggcaacaccacagcttactaacaag
aatcccaaaatgagccgaagtgttggatattcatatccctccttaccacctggttatcag
aacacaacaccacctggtgcaactggagtaccaccctcttccttgaattacccaagtggg
ccacaagcctttactcagactcccttaggtgctaatcatttaaccacaagcatgagtgga
ttaagtctacaaccagagggtctaagagttgtcaatcttcttcaagaaagaaacatgctt
ccgtcaacacctttgaagcctccagttccaaatttgcatgaagacatccagaaactcaac
tgtaacccagagttatttcgatgcacgctgactagcattcctcagacgcaggccttattg
aataaagccaaacttcctttggggctgctgcttcatcctttcaaagacttagtgcaattg
cctgtggttacctccagtacaattgtgagatgccgttcatgcaggacgtacatcaatcct
ttcgtcagctttcttgatcaaaggagatggaagtgtaacttatgttatcgagtcaatgat
gttcctgaagaattcttgtacaaccctttgaccagagtttatggagaacctcacagaaga
ccagaagttcaaaatgctactattgagtttatggctccttcagaatacatgttacgacca
cctcagcctccagtgtatctctttgtatttgatgtgtctcacaatgcagtcgaaactgga
tacttgaattcagtttgccagagtttgttagacaatctggatttgcttcctggcaacact
agaacaaaaattggcttcataacatttgacagtacaatccatttctacggtcttcaggaa
agtctctctcaacctcagatgctaatagtttcagatattgaagatgtttttatacctatg
ccagagaacttattagtaaacttaaatgaaagtaaagagagtgtcattggggtcagttca
gaagaaactcttattacctgcctggaaattgccatgagataa

DBGET integrated database retrieval system