KEGG   Homo sapiens (human): 10808Help
Entry
10808             CDS       T01001                                 

Gene name
HSPH1, HSP105, HSP105A, HSP105B, NY-CO-25
Definition
heat shock 105kDa/110kDa protein 1
Orthology
K09485  
heat shock protein 110kDa
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.3
AA seq 814 aa AA seqDB search
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM
LLTKLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGK
DISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDANEKKVDQPPEA
KKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYE
FRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKV
RFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNN
VMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKK
EEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggtggggttggacgtgggctcgcagagctgctacatcgcggtagcccgggcc
gggggcatcgagaccatcgccaatgagttcagcgaccggtgcaccccgtcagtcatatca
tttggatcaaaaaatagaacaatcggagttgcagccaaaaatcagcaaatcactcatgca
aacaatacggtgtctaacttcaaaagatttcatggccgagcattcaatgaccccttcatt
caaaaggagaaggaaaacttgagttacgatttggttccattgaaaaatggtggagttgga
ataaaggtaatgtacatgggtgaagaacatctatttagtgtggagcagataacagccatg
ttgttgactaagctgaaggaaactgctgaaaacagcctcaagaaaccagtaacagattgt
gttatttcagtcccctccttctttacagatgctgagaggcgatctgtgttagatgctgca
cagattgttggcctaaactgtttaagacttatgaatgacatgacagctgttgctttgaat
tacggaatttataagcaggatctcccaagcctggatgagaaacctcggatagtggttttt
gttgatatgggacattcagcttttcaagtgtctgcttgtgcttttaacaagggaaaattg
aaggtactgggaacagcttttgatcctttcttaggaggaaaaaacttcgatgaaaagtta
gtggaacatttttgtgcagaatttaaaactaagtacaagttggatgcaaaatccaaaata
cgagcactcctacgtctgtatcaggaatgtgaaaaactgaaaaagctaatgagctctaac
agcacagaccttccactgaatatcgaatgctttatgaatgataaagatgtttccggaaag
atgaacaggtcacaatttgaagaactctgtgctgaacttctgcaaaagatagaagtaccc
ctttattcactgttggaacaaactcatctcaaagtagaagatgtgagtgcagttgagatt
gttggaggcgctacacgaattccagctgtgaaggaaagaattgccaaattctttggaaaa
gatattagcacaacactcaatgcagatgaagcagtagccagaggatgtgcattacagtgt
gcaatactttccccggcatttaaagttagagaattttccgtcacagatgcagttcctttt
ccaatatctctgatctggaaccatgattcagaagatactgaaggtgttcatgaagtcttt
agtcgaaaccatgctgctcctttctccaaagttctcacctttctgagaagggggcctttt
gagctagaagctttctattctgatccccaaggagttccatatccagaagcaaaaataggc
cgctttgtagttcagaatgtttctgcacagaaagatggagaaaaatctagagtaaaagtc
aaagtgcgagtcaacacccatggcattttcaccatctctacggcatctatggtggagaaa
gtcccaactgaggagaatgaaatgtcttctgaagctgacatggagtgtctgaatcagaga
ccaccagaaaacccagacactgatgcaaatgaaaaaaaagttgaccagcctccagaagct
aaaaagcccaaaataaaggtggtgaatgttgagctgcctattgaagccaacttggtctgg
cagttagggaaagaccttcttaacatgtatattgagacagagggtaagatgataatgcaa
gataaattggaaaaagaaaggaatgatgctaaaaatgcagttgaggaatatgtgtatgag
ttcagagacaagctgtgtggaccatatgaaaaatttatatgtgagcaggatcatcaaaat
tttttgagactcctcacagaaactgaagactggctgtatgaagaaggagaggaccaagct
aaacaagcatatgttgacaagttggaagaattaatgaaaattggcactccagttaaagtt
cggtttcaggaagctgaagaacggccaaaaatgtttgaagaactaggacagaggctgcag
cattatgccaagatagcagctgacttcagaaataaggatgagaaatacaaccatattgat
gagtctgaaatgaaaaaagtggagaagtctgttaatgaagtgatggaatggatgaataat
gtcatgaatgctcaggctaaaaagagtcttgatcaggatccagttgtacgtgctcaggaa
attaaaacaaaaatcaaggaattgaacaacacatgtgaacccgttgtaacacaaccgaaa
ccaaaaattgaatcacccaaactggaaagaactccaaatggcccaaatattgataaaaag
gaagaagatttagaagacaaaaacaattttggtgctgaacctccacatcagaatggtgaa
tgttaccctaatgagaaaaattctgttaatatggacttggactag

DBGET integrated database retrieval system