KEGG   Homo sapiens (human): 10808Help
Entry
10808             CDS       T01001                                 

Gene name
HSPH1, HSP105, HSP105A, HSP105B, NY-CO-25
Definition
(RefSeq) heat shock protein family H (Hsp110) member 1
  KO
K09485  
heat shock protein 110kDa
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10808 (HSPH1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP110
   10808 (HSPH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12.3
AA seq 858 aa AA seqDB search
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM
LLTKLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGK
DISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGT
QPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEA
NLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQ
DHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELG
QRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVV
RAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH
QNGECYPNEKNSVNMDLD
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtggtggggttggacgtgggctcgcagagctgctacatcgcggtagcccgggcc
gggggcatcgagaccatcgccaatgagttcagcgaccggtgcaccccgtcagtcatatca
tttggatcaaaaaatagaacaatcggagttgcagccaaaaatcagcaaatcactcatgca
aacaatacggtgtctaacttcaaaagatttcatggccgagcattcaatgaccccttcatt
caaaaggagaaggaaaacttgagttacgatttggttccattgaaaaatggtggagttgga
ataaaggtaatgtacatgggtgaagaacatctatttagtgtggagcagataacagccatg
ttgttgactaagctgaaggaaactgctgaaaacagcctcaagaaaccagtaacagattgt
gttatttcagtcccctccttctttacagatgctgagaggcgatctgtgttagatgctgca
cagattgttggcctaaactgtttaagacttatgaatgacatgacagctgttgctttgaat
tacggaatttataagcaggatctcccaagcctggatgagaaacctcggatagtggttttt
gttgatatgggacattcagcttttcaagtgtctgcttgtgcttttaacaagggaaaattg
aaggtactgggaacagcttttgatcctttcttaggaggaaaaaacttcgatgaaaagtta
gtggaacatttttgtgcagaatttaaaactaagtacaagttggatgcaaaatccaaaata
cgagcactcctacgtctgtatcaggaatgtgaaaaactgaaaaagctaatgagctctaac
agcacagaccttccactgaatatcgaatgctttatgaatgataaagatgtttccggaaag
atgaacaggtcacaatttgaagaactctgtgctgaacttctgcaaaagatagaagtaccc
ctttattcactgttggaacaaactcatctcaaagtagaagatgtgagtgcagttgagatt
gttggaggcgctacacgaattccagctgtgaaggaaagaattgccaaattctttggaaaa
gatattagcacaacactcaatgcagatgaagcagtagccagaggatgtgcattacagtgt
gcaatactttccccggcatttaaagttagagaattttccgtcacagatgcagttcctttt
ccaatatctctgatctggaaccatgattcagaagatactgaaggtgttcatgaagtcttt
agtcgaaaccatgctgctcctttctccaaagttctcacctttctgagaagggggcctttt
gagctagaagctttctattctgatccccaaggagttccatatccagaagcaaaaataggc
cgctttgtagttcagaatgtttctgcacagaaagatggagaaaaatctagagtaaaagtc
aaagtgcgagtcaacacccatggcattttcaccatctctacggcatctatggtggagaaa
gtcccaactgaggagaatgaaatgtcttctgaagctgacatggagtgtctgaatcagaga
ccaccagaaaacccagacactgataaaaatgtccagcaagacaacagtgaagctggaaca
cagccccaggtacaaactgatgctcaacaaacctcacagtctcccccttcacctgaactt
acctcagaagaaaacaaaatcccagatgctgacaaagcaaatgaaaaaaaagttgaccag
cctccagaagctaaaaagcccaaaataaaggtggtgaatgttgagctgcctattgaagcc
aacttggtctggcagttagggaaagaccttcttaacatgtatattgagacagagggtaag
atgataatgcaagataaattggaaaaagaaaggaatgatgctaaaaatgcagttgaggaa
tatgtgtatgagttcagagacaagctgtgtggaccatatgaaaaatttatatgtgagcag
gatcatcaaaattttttgagactcctcacagaaactgaagactggctgtatgaagaagga
gaggaccaagctaaacaagcatatgttgacaagttggaagaattaatgaaaattggcact
ccagttaaagttcggtttcaggaagctgaagaacggccaaaaatgtttgaagaactagga
cagaggctgcagcattatgccaagatagcagctgacttcagaaataaggatgagaaatac
aaccatattgatgagtctgaaatgaaaaaagtggagaagtctgttaatgaagtgatggaa
tggatgaataatgtcatgaatgctcaggctaaaaagagtcttgatcaggatccagttgta
cgtgctcaggaaattaaaacaaaaatcaaggaattgaacaacacatgtgaacccgttgta
acacaaccgaaaccaaaaattgaatcacccaaactggaaagaactccaaatggcccaaat
attgataaaaaggaagaagatttagaagacaaaaacaattttggtgctgaacctccacat
cagaatggtgaatgttaccctaatgagaaaaattctgttaatatggacttggactag

DBGET integrated database retrieval system