KEGG   Homo sapiens (human): 1081Help
Entry
1081              CDS       T01001                                 

Gene name
CGA, CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA
Definition
glycoprotein hormones, alpha polypeptide
Orthology
K08522  
glycoprotein hormones, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
GnRH signaling pathway
Ovarian steroidogenesis
Prolactin signaling pathway
Thyroid hormone synthesis
Autoimmune thyroid disease
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:hsa05320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q12-q21
AA seq 116 aa AA seqDB search
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatctttctggtcacattgtcggtgtttctgcat
gttctccattccgctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtccaaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

DBGET integrated database retrieval system