KEGG   Homo sapiens (human): 1081Help
Entry
1081              CDS       T01001                                 

Gene name
CGA, CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA
Definition
glycoprotein hormones, alpha polypeptide
Orthology
K08522  
glycoprotein hormones, alpha polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
GnRH signaling pathway
Ovarian steroidogenesis
Prolactin signaling pathway
Thyroid hormone synthesis
Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1081 (CGA)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    1081 (CGA)
   04913 Ovarian Steroidogenesis
    1081 (CGA)
   04917 Prolactin signaling pathway
    1081 (CGA)
   04918 Thyroid hormone synthesis
    1081 (CGA)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    1081 (CGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q12-q21
AA seq 116 aa AA seqDB search
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctatctttctggtcacattgtcggtgtttctgcat
gttctccattccgctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtccaaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

DBGET integrated database retrieval system