KEGG   Homo sapiens (human): 10810Help
Entry
10810             CDS       T01001                                 

Gene name
WASF3, Brush-1, SCAR3, WAVE3
Definition
(RefSeq) WAS protein family member 3
  KO
K06083  
WAS protein family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Fc gamma R-mediated phagocytosis
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    10810 (WASF3)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10810 (WASF3)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    10810 (WASF3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     10810 (WASF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9UPY6(Tbio)
UniProt: 
Position
13q12.13
AA seq 502 aa AA seqDB search
MPLVKRNIEPRHLCRGALPEGITSELECVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAN
NFYIRANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSIPNP
VADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYFFDLWKEKMLQDTEDKRKEKRRQK
EQKRIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGSLSPDTRS
HASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNR
PQQPPPPPPPQAPEGSQASAPMAPADYGMLPAQIIEYYNPSGPPPPPPPPVIPSAQTAFV
SPLQMPMQPPFPASASSTHAAPPHPPSTGLLVTAPPPPGPPPPPPGPPGPGSSLSSSPMH
GPPVAEAKRQEPAQPPISDARSDLLAAIRMGIQLKKVQEQREQEAKREPVGNDVATILSR
RIAVEYSDSDDDSEFDENDWSD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtgaagaggaacattgagccccggcacttgtgccggggagctctgcctgaa
gggattaccagcgaacttgaatgtgtaaccaatagtactcttgccgctatcatacgccag
ctgagcagtctgagcaaacatgctgaagacatatttggtgagttgtttaatgaggctaac
aacttctacatcagagcaaattctcttcaagacagaattgatcgccttgctgtcaaagtc
acccagctggattcaacagtggaagaggtctcactacaggatatcaacatgaaaaaagct
ttcaaaagttccacagtccaagaccagcaagtggtttcaaagaacagcattcctaatcct
gttgctgatatttacaaccagagtgataagccaccgcctctgaacatcctgacaccatac
agagatgacaagaaggatgggctgaagttctatactgatccttcctatttctttgacctc
tggaaagaaaaaatgctacaggacacagaagacaaaaggaaagagaaaaggcgtcaaaag
gagcaaaagcgtatagatggcaccacccgtgaggtgaaaaaggttagaaaagccagaaac
aggcgccaggagtggaatatgatggcatatgacaaagagcttagacccgacaacaggttg
tctcagagtgtgtaccatggagcgtcttccgagggatccctgtccccagatactaggtca
catgcatcggacgttacggattactcttacccggctactcccaaccattctctgcacccc
cagcctgtgaccccttcctatgcagctggtgacgtgccaccacacgggcctgcaagccag
gctgcggagcatgagtaccggcccccatctgcctcggcgaggcacatggccctcaacaga
cctcagcagccgccccccccgcctccccctcaggccccagaggggtcccaggcctctgca
ccgatggctccagcagactacgggatgctcccagcgcagataattgagtattacaaccca
tccggaccacctcctccgccacctcctcctgtgattccctcagcacaaactgccttcgtc
agccctctccagatgcccatgcagcccccgttccctgcatcagccagctccacgcacgca
gctcctcctcacccaccctccaccgggctcctggtcacagccccgccacccccgggccca
ccacctcccccgccaggccctcctggtcccgggtcttctctttcgtcctccccaatgcat
ggccccccagtagctgaggcgaagcggcaagagcctgcacagccaccaatcagtgatgct
cgaagcgacctcctcgctgctattcgaatgggaattcaactgaaaaaggtgcaggagcag
cgggagcaggaggccaagcgggagccagtggggaatgacgtggccacgatcctgtcccgg
cgcattgccgtggagtacagcgactctgacgacgactcagagttcgacgagaacgactgg
tccgactga

DBGET integrated database retrieval system