KEGG   Homo sapiens (human): 10813Help
Entry
10813             CDS       T01001                                 

Gene name
UTP14A, NYCO16, SDCCAG16, dJ537K23.3
Definition
(RefSeq) UTP14A small subunit processome component
  KO
K14567  
U3 small nucleolar RNA-associated protein 14
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    10813 (UTP14A)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    10813 (UTP14A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.1
AA seq 771 aa AA seqDB search
MTANRLAESLLALSQQEELADLPKDYLLSESEDEGDNDGERKHQKLLEAISSLDGKNRRK
LAERSEASLKVSEFNVSSEGSGEKLVLADLLEPVKTSSSLATVKKQLSRVKSKKTVELPL
NKEEIERIHREVAFNKTAQVLSKWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKA
RTPLEQEIFNLLHKNKQPVTDPLLTPVEKASLRAMSLEEAKMRRAELQRARALQSYYEAK
ARREKKIKSKKYHKVVKKGKAKKALKEFEQLRKVNPAAALEELEKIEKARMMERMSLKHQ
NSGKWAKSKAIMAKYDLEARQAMQEQLSKNKELTQKLQVASESEEEEGGTEDVEELLVPD
VVNEVQMNADGPNPWMLRSCTSDTKEAATQEDPEQLPELEAHGVSESEGEERPVAEEEIL
LREFEERRSLRKRSELSQDAEPAGSQETKDSGSQEVLSELRVLSQKLKENHQSRKQKASS
EGTIPQVQREEPAPEEEEPLLLQRPERVQTLEELEELGKEECFQNKELPRPVLEGQQSER
TPNNRPDAPKEKKKKEQMIDLQNLLTTQSPSVKSLAVPTIEELEDEEERNHRQMIKEAFA
GDDVIRDFLKEKREAVEASKPKDVDLTLPGWGEWGGVGLKPSAKKRRRFLIKAPEGPPRK
DKNLPNVIINEKRNIHAAAHQVRVLPYPFTHHWQFERTIQTPIGSTWNTQRAFQKLTTPK
VVTKPGHIINPIKAEDVGYRSSSRSDLSVIQRNPKRITTRHKKQLKKCSVD
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgaaccggcttgcagagagccttctggctttgagccaacaggaagaactagcg
gatttgccaaaagactacctcttgagtgagagtgaagatgagggggacaatgatggagag
agaaagcatcaaaagcttctggaagcaatcagttcccttgatggaaagaataggcggaaa
ttggctgagaggtctgaggctagtctgaaggtgtcagagttcaatgtcagttctgaagga
tcaggagaaaagctggtccttgcagatctgcttgagcctgttaaaacttcatcttctttg
gccactgtgaaaaagcaactgagtagagtcaaatcaaagaagacagtggagttacctctg
aacaaagaagagattgaacggatccacagagaagtagcattcaataaaaccgcacaagtc
ctctccaaatgggaccctgtcgtcctgaagaaccggcaggcagagcagctggtttttccc
ctggagaaagaggagccagccattgctcccattgaacatgtgctcagtggctggaaggca
agaactcccctggagcaggaaattttcaacctcctccataagaacaagcagccagtgaca
gaccctttactgacccctgtggaaaaggcctctctccgagccatgagcctagaagaggca
aagatgcgacgagcagagcttcagagggctcgggctctgcagtcctactatgaggccaag
gctcgaagagagaagaaaatcaaaagtaaaaagtatcacaaagtcgtgaagaaaggaaag
gccaagaaagccctaaaagagtttgagcagctgcggaaggttaatccagctgcagcacta
gaagaactggaaaaaattgaaaaggccagaatgatggaaagaatgagccttaagcaccaa
aacagtgggaaatgggccaagtcaaaggcaattatggccaaatatgacctggaggctcgc
caagctatgcaggaacagttgtctaagaacaaagaactgacacagaaactccaggtagcc
tctgagagtgaggaagaggagggaggcacagaagatgtggaagaactccttgtccctgat
gtagtgaatgaagtgcagatgaatgcagatgggccgaatccctggatgctcaggagctgc
accagtgacaccaaagaggctgcaacccaggaggaccctgagcaactgccagagcttgag
gcccatggagtttctgaaagtgagggagaagaaagaccagtggcagaagaagaaattttg
ttgagagaatttgaggaaaggcgatcccttagaaaaagatctgagctcagccaagatgct
gagccagcaggcagtcaagaaacaaaagattctggcagccaggaggtgctgtctgaattg
agagtactatctcagaaattgaaggaaaaccatcagtccaggaagcaaaaagcaagttca
gaggggactattccccaggtccagagagaggaacctgccccagaagaagaggagcccctg
ttgctacagagaccagagagagtacagacgctggaagagctagaagagctgggaaaagaa
gaatgttttcaaaataaggagcttcccagacctgtgttagaagggcagcagtcagagagg
accccaaataatcgccctgatgcccctaaggagaagaaaaagaaggagcaaatgatcgac
ctacagaacctcctaaccacacaatctccctccgtgaagtctttggcagttcccacaata
gaggagctggaagatgaagaggagagaaaccataggcagatgataaaggaagcttttgct
ggggatgatgtcatcagagatttcttgaaagagaagagggaagctgtggaggcgagtaag
ccaaaggacgtggacctgacactacctggctggggcgagtggggtggtgtgggcctaaag
cccagtgccaagaaaagacgccggtttctcattaaagcccctgagggtcctccaagaaaa
gataagaatttgccaaatgtgattatcaatgagaagcgcaacatccacgcagctgctcat
caggtacgagtgcttccatatccatttacccaccattggcaatttgaaaggaccatccag
acccccataggatccacatggaacacccagagggctttccaaaagctgactactcccaag
gtcgtcaccaagccaggccatatcattaaccccataaaagcagaagacgtgggctaccgg
tcttcctcaaggtcggacctgtctgtcatacagaggaatccaaaacgaatcaccacacgt
cacaaaaaacagctgaagaaatgctctgtagattga

DBGET integrated database retrieval system