KEGG   Homo sapiens (human): 10814Help
Entry
10814             CDS       T01001                                 

Gene name
CPLX2, 921-L, CPX-2, CPX2, Hfb1
Definition
complexin 2
Orthology
K15294  
complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    10814 (CPLX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.2
AA seq 134 aa AA seqDB search
MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAERE
KVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTV
LKYLPGPLQDMFKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgtcatgaagcaggcccttggaggggccacaaaggacatggggaagatgctg
gggggagaggaggagaaggaccccgacgcgcagaaaaaggaggaggagcggcaggaggcg
ctgcggcagcaggaggaggagcgtaaggccaagcacgcgcgcatggaggcggagcgggag
aaggtccggcagcagatccgagataagtatgggctgaagaagaaggaggagaaggaagca
gaggagaaagcagccctggagcagccctgcgaggggagcctgacccggcccaagaaggcc
atccctgcgggctgcggggacgaggaggaggaggaagaggagagcatcctggacacggtg
ctcaaatacctgcccgggccgctgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system