KEGG   Homo sapiens (human): 10815Help
Entry
10815             CDS       T01001                                 

Gene name
CPLX1, CPX-I, CPX1
Definition
(RefSeq) complexin 1
  KO
K15294  complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Disease
H01773  4p deletion syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    10815 (CPLX1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    10815 (CPLX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaphin
Motif
Other DBs
NCBI-GeneID: 10815
NCBI-ProteinID: NP_006642
OMIM: 605032
HGNC: 2309
Ensembl: ENSG00000168993
Vega: OTTHUMG00000160005
Pharos: O14810(Tbio)
UniProt: O14810
Position
4p16.3
AA seq 134 aa AA seqDB search
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTV
IKYLPGPLQDMLKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtgatgaagcaggctctaggaggggccaccaaggacatggggaagatgctg
gggggtgacgaggagaaggacccagacgccgccaagaaggaggaggagcggcaggaggcg
ctgcgccaggcggaggaggagcgcaaggccaagtacgccaagatggaggcggagcgcgag
gccgtgcgccagggcatccgagacaagtacggcatcaagaagaaggaggagcgcgaggcc
gaggcccaggccgccatggaggccaactccgaggggagcttgacgcggcccaagaaggcc
atcccgccgggctgcggggacgaggtggaggaggaggacgagagcatcctggacaccgtc
atcaagtacctgcccgggccgctgcaggacatgctcaagaagtag

DBGET integrated database retrieval system