KEGG   Homo sapiens (human): 10815Help
Entry
10815             CDS       T01001                                 

Gene name
CPLX1, CPX-I, CPX1
Definition
complexin 1
Orthology
K15294  
complexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 134 aa AA seqDB search
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTV
IKYLPGPLQDMLKK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgtgatgaagcaggctctaggaggggccaccaaggacatggggaagatgctg
gggggtgacgaggagaaggacccagacgccgccaagaaggaggaggagcggcaggaggcg
ctgcgccaggcggaggaggagcgcaaggccaagtacgccaagatggaggcggagcgcgag
gccgtgcgccagggcatccgagacaagtacggcatcaagaagaaggaggagcgcgaggcc
gaggcccaggccgccatggaggccaactccgaggggagcttgacgcggcccaagaaggcc
atcccgccgggctgcggggacgaggtggaggaggaggacgagagcatcctggacaccgtc
atcaagtacctgcccgggccgctgcaggacatgctcaagaagtag

DBGET integrated database retrieval system