KEGG   Homo sapiens (human): 10826Help
Entry
10826             CDS       T01001                                 

Gene name
FAXDC2, C5orf4
Definition
fatty acid hydroxylase domain containing 2
Orthology
K07750  
methylsterol monooxygenase [EC:1.14.13.72]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:hsa00100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31-q32
AA seq 333 aa AA seqDB search
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaagctggacatatgctacacaatgaaaagtcaaagcaggagggacacatc
tggggctctatgaggaggacagctttcatcctgggctctggacttctctcatttgtggcc
ttctggaactcagtgacatggcatcttcagagattttggggtgcttctggctacttttgg
caagcccagtgggagaggctgctgactacatttgaagggaaggagtggatcctcttcttt
ataggtgccatccaagtgccttgtctcttcttctggagcttcaatgggcttctattggtg
gttgacacaacaggaaaacctaacttcatctctcgctaccgaattcaggtcggcaagaat
gaacctgtggatcctgtgaaactgcgccagtctatccgcacagttcttttcaaccagtgc
atgatatctttccccatggtggtcttcctctatcccttcctcaaatggtggagagacccc
tgccgccgtgagctacccaccttccactggttcctcctggagctggccatcttcacgctg
atcgaggaagtcttgttctactattcacaccggctccttcaccacccaacattctacaag
aaaatccacaagaaacaccatgagtggacagctcccattggcgtgatctctctctatgcc
caccctatagagcatgcagtctccaacatgctaccggtgatagtgggcccattagtaatg
ggctcccacttgtcctccatcaccatgtggttttccttggccctcatcatcaccaccatc
tcccactgtggctaccaccttcccttcctgccttcgcctgaattccacgactaccaccat
ctcaagttcaaccagtgctatggggtgctgggtgtgctggaccacctccatgggactgac
accatgttcaagcagaccaaggcctacgagagacatgtcctcctgctgggcttcaccccg
ctctctgagagcatcccagactccccaaagaggatggagtga

DBGET integrated database retrieval system