KEGG   Homo sapiens (human): 10826Help
Entry
10826             CDS       T01001                                 

Gene name
FAXDC2, C5orf4
Definition
(RefSeq) fatty acid hydroxylase domain containing 2
  KO
K22282  fatty acid hydroxylase domain-containing protein 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FA_hydroxylase
Motif
Other DBs
NCBI-GeneID: 10826
NCBI-ProteinID: NP_115761
HGNC: 1334
Ensembl: ENSG00000170271
Vega: OTTHUMG00000164141
Pharos: Q96IV6(Tdark)
UniProt: Q96IV6
Position
5q33.2
AA seq 333 aa AA seqDB search
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaagctggacatatgctacacaatgaaaagtcaaagcaggagggacacatc
tggggctctatgaggaggacagctttcatcctgggctctggacttctctcatttgtggcc
ttctggaactcagtgacatggcatcttcagagattttggggtgcttctggctacttttgg
caagcccagtgggagaggctgctgactacatttgaagggaaggagtggatcctcttcttt
ataggtgccatccaagtgccttgtctcttcttctggagcttcaatgggcttctattggtg
gttgacacaacaggaaaacctaacttcatctctcgctaccgaattcaggtcggcaagaat
gaacctgtggatcctgtgaaactgcgccagtctatccgcacagttcttttcaaccagtgc
atgatatctttccccatggtggtcttcctctatcccttcctcaaatggtggagagacccc
tgccgccgtgagctacccaccttccactggttcctcctggagctggccatcttcacgctg
atcgaggaagtcttgttctactattcacaccggctccttcaccacccaacattctacaag
aaaatccacaagaaacaccatgagtggacagctcccattggcgtgatctctctctatgcc
caccctatagagcatgcagtctccaacatgctaccggtgatagtgggcccattagtaatg
ggctcccacttgtcctccatcaccatgtggttttccttggccctcatcatcaccaccatc
tcccactgtggctaccaccttcccttcctgccttcgcctgaattccacgactaccaccat
ctcaagttcaaccagtgctatggggtgctgggtgtgctggaccacctccatgggactgac
accatgttcaagcagaccaaggcctacgagagacatgtcctcctgctgggcttcaccccg
ctctctgagagcatcccagactccccaaagaggatggagtga

DBGET integrated database retrieval system