KEGG   Homo sapiens (human): 10826Help
Entry
10826             CDS       T01001                                 

Gene name
FAXDC2, C5orf4
Definition
fatty acid hydroxylase domain containing 2
Orthology
K07750  
methylsterol monooxygenase [EC:1.14.13.72]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    10826 (FAXDC2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.72  methylsterol monooxygenase
     10826 (FAXDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31-q32
AA seq 333 aa AA seqDB search
MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW
QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN
EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL
IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM
GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD
TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaagctggacatatgctacacaatgaaaagtcaaagcaggagggacacatc
tggggctctatgaggaggacagctttcatcctgggctctggacttctctcatttgtggcc
ttctggaactcagtgacatggcatcttcagagattttggggtgcttctggctacttttgg
caagcccagtgggagaggctgctgactacatttgaagggaaggagtggatcctcttcttt
ataggtgccatccaagtgccttgtctcttcttctggagcttcaatgggcttctattggtg
gttgacacaacaggaaaacctaacttcatctctcgctaccgaattcaggtcggcaagaat
gaacctgtggatcctgtgaaactgcgccagtctatccgcacagttcttttcaaccagtgc
atgatatctttccccatggtggtcttcctctatcccttcctcaaatggtggagagacccc
tgccgccgtgagctacccaccttccactggttcctcctggagctggccatcttcacgctg
atcgaggaagtcttgttctactattcacaccggctccttcaccacccaacattctacaag
aaaatccacaagaaacaccatgagtggacagctcccattggcgtgatctctctctatgcc
caccctatagagcatgcagtctccaacatgctaccggtgatagtgggcccattagtaatg
ggctcccacttgtcctccatcaccatgtggttttccttggccctcatcatcaccaccatc
tcccactgtggctaccaccttcccttcctgccttcgcctgaattccacgactaccaccat
ctcaagttcaaccagtgctatggggtgctgggtgtgctggaccacctccatgggactgac
accatgttcaagcagaccaaggcctacgagagacatgtcctcctgctgggcttcaccccg
ctctctgagagcatcccagactccccaaagaggatggagtga

DBGET integrated database retrieval system