KEGG   Homo sapiens (human): 10848Help
Entry
10848             CDS       T01001                                 

Gene name
PPP1R13L, IASPP, NKIP1, RAI, RAI4
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 13 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 828 aa AA seqDB search
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaggcattccagagcgcgcgggactttctggacatgaacttccagtcgctg
gccatgaaacacatggatctgaagcagatggagctggacacggcggcggccaaggtggat
gaactgaccaagcagctggagtcgctgtggtcagactctcccgcgcctcctggcccgcag
gccggacccccttctaggccgccccggtacagctccagctcgatccctgagcccttcggc
agccgagggtccccccggaaggcggccaccgacggcgcagacaccccgttcggacgatca
gagagtgccccaaccctacacccctacagcccgctgtcccccaagggacggccgtcgtcg
ccgcgcaccccgctctacctgcagccggacgcctacggcagcctggaccgcgcgacctcg
ccccggccccgcgccttcgatggcgcaggcagctccctcggccgtgcgccctccccgcgg
cccgggccaggcccgctccgccagcagggtccccccacgcctttcgacttcctgggccgc
gcaggctccccccgcggcagccccctggcggaggggccccaggccttcttccccgagcgt
gggccgtcaccgcgcccccctgccacagcctacgacgcgccagcgtccgccttcgggagc
tccctgctaggctccggcggcagcgcattcgccccgcctctgcgcgcgcaagacgacctg
acgctgcgccggcggcctccgaaagcctggaacgagtctgacctggacgtggcgtacgag
aagaagccttcgcagacagcgagctatgaacgcctggacgtcttcgcaaggcctgcctcg
ccgagcctgcagctgttgccttggagggagagcagcctggatggactggggggcaccggc
aaggacaacctcactagcgccaccctgccgcgcaattacaaggtctctcctctggccagc
gaccggcgttcagacgcgggcagctaccggcgctcgctgggctccgcggggccgtcgggc
actttgcctcgcagctggcagcccgtcagccgcatccccatgcccccctccagcccccag
ccccgcggggccccgcgccagcgtcccatccccctcagcatgatcttcaagctgcagaac
gccttctgggagcacggggccagccgcgccatgctccctgggtcccccctcttcacccga
gcacccccgcctaagctgcagccccaaccacaaccacagccccagccacaatcacaacca
cagccccagctgcccccacagccccagacccaaccccaaacccctaccccagccccccag
catccccaacagacatggccccctgtgaacgaaggaccccccaaaccccccaccgagctg
gagcctgagccggagatagaggggctgctgacaccagtgctggaggctggcgatgtggat
gaaggccctgtagcaaggcctctcagccccacgaggctgcagccagcactgccaccggag
gcacagtcggtgcccgagctggaggaggtggcacgggtgttggcggaaattccccggccc
ctcaaacgcaggggctccatggagcaggcccctgctgtggccctgccccctacccacaag
aaacagtaccagcagatcatcagccgcctcttccatcgtcatggggggccagggcccggg
gggccggagccagagctgtcccccatcactgagggatctgaggccagggcagggccccct
gctcctgccccaccagctcccattccacccccggccccgtcccagagcagcccaccagag
cagccgcagagcatggagatgcgctctgtgctgcggaaggcgggctccccgcgcaaggcc
cgccgcgcgcgcctcaaccctctggtgctcctcctggacgcggcgctgaccggggagctg
gaggtggtgcagcaggcggtgaaggagatgaacgacccgagccagcccaacgaggagggc
atcactgccttgcacaacgccatctgcggcgccaactactctatcgtggatttcctcatc
accgcgggtgccaatgtcaactcccccgacagccacggctggacacccttgcactgcgcg
gcgtcgtgcaacgacacagtcatctgcatggcgctggtgcagcacggcgctgcaatcttc
gccaccacgctcagcgacggcgccaccgccttcgagaagtgcgacccttaccgcgagggt
tatgctgactgcgccacctacctggcagacgtcgagcagagtatggggctgatgaacagc
ggggcagtgtacgctctctgggactacagcgccgagttcggggacgagctgtccttccgc
gagggcgagtcggtcaccgtgctgcggagggacgggccggaggagaccgactggtggtgg
gccgcgctgcacggccaggagggctacgtgccgcggaactacttcgggctgttccccagg
gtgaagcctcaaaggagtaaagtctag

DBGET integrated database retrieval system