KEGG   Homo sapiens (human): 10848Help
Entry
10848             CDS       T01001                                 

Gene name
PPP1R13L, IASPP, NKIP1, RAI, RAI4
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 13 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 SH3_9 Ank SH3_1 Ank_3 Ank_5 Ank_4 SH3_2
Motif
Other DBs
NCBI-GeneID: 10848
NCBI-ProteinID: NP_001135974
OMIM: 607463
HGNC: 18838
Ensembl: ENSG00000104881
Vega: OTTHUMG00000181784
Pharos: Q8WUF5(Tbio)
UniProt: Q8WUF5 A0A024R0Q5
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 828 aa AA seqDB search
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgaggcattccagagcgcgcgggactttctggacatgaacttccagtcgctg
gccatgaaacacatggatctgaagcagatggagctggacacggcggcggccaaggtggat
gaactgaccaagcagctggagtcgctgtggtcagactctcccgcgcctcctggcccgcag
gccggacccccttctaggccgccccggtacagctccagctcgatccctgagcccttcggc
agccgagggtccccccggaaggcggccaccgacggcgcagacaccccgttcggacgatca
gagagtgccccaaccctacacccctacagcccgctgtcccccaagggacggccgtcgtcg
ccgcgcaccccgctctacctgcagccggacgcctacggcagcctggaccgcgcgacctcg
ccccggccccgcgccttcgatggcgcaggcagctccctcggccgtgcgccctccccgcgg
cccgggccaggcccgctccgccagcagggtccccccacgcctttcgacttcctgggccgc
gcaggctccccccgcggcagccccctggcggaggggccccaggccttcttccccgagcgt
gggccgtcaccgcgcccccctgccacagcctacgacgcgccagcgtccgccttcgggagc
tccctgctaggctccggcggcagcgcattcgccccgcctctgcgcgcgcaagacgacctg
acgctgcgccggcggcctccgaaagcctggaacgagtctgacctggacgtggcgtacgag
aagaagccttcgcagacagcgagctatgaacgcctggacgtcttcgcaaggcctgcctcg
ccgagcctgcagctgttgccttggagggagagcagcctggatggactggggggcaccggc
aaggacaacctcactagcgccaccctgccgcgcaattacaaggtctctcctctggccagc
gaccggcgttcagacgcgggcagctaccggcgctcgctgggctccgcggggccgtcgggc
actttgcctcgcagctggcagcccgtcagccgcatccccatgcccccctccagcccccag
ccccgcggggccccgcgccagcgtcccatccccctcagcatgatcttcaagctgcagaac
gccttctgggagcacggggccagccgcgccatgctccctgggtcccccctcttcacccga
gcacccccgcctaagctgcagccccaaccacaaccacagccccagccacaatcacaacca
cagccccagctgcccccacagccccagacccaaccccaaacccctaccccagccccccag
catccccaacagacatggccccctgtgaacgaaggaccccccaaaccccccaccgagctg
gagcctgagccggagatagaggggctgctgacaccagtgctggaggctggcgatgtggat
gaaggccctgtagcaaggcctctcagccccacgaggctgcagccagcactgccaccggag
gcacagtcggtgcccgagctggaggaggtggcacgggtgttggcggaaattccccggccc
ctcaaacgcaggggctccatggagcaggcccctgctgtggccctgccccctacccacaag
aaacagtaccagcagatcatcagccgcctcttccatcgtcatggggggccagggcccggg
gggccggagccagagctgtcccccatcactgagggatctgaggccagggcagggccccct
gctcctgccccaccagctcccattccacccccggccccgtcccagagcagcccaccagag
cagccgcagagcatggagatgcgctctgtgctgcggaaggcgggctccccgcgcaaggcc
cgccgcgcgcgcctcaaccctctggtgctcctcctggacgcggcgctgaccggggagctg
gaggtggtgcagcaggcggtgaaggagatgaacgacccgagccagcccaacgaggagggc
atcactgccttgcacaacgccatctgcggcgccaactactctatcgtggatttcctcatc
accgcgggtgccaatgtcaactcccccgacagccacggctggacacccttgcactgcgcg
gcgtcgtgcaacgacacagtcatctgcatggcgctggtgcagcacggcgctgcaatcttc
gccaccacgctcagcgacggcgccaccgccttcgagaagtgcgacccttaccgcgagggt
tatgctgactgcgccacctacctggcagacgtcgagcagagtatggggctgatgaacagc
ggggcagtgtacgctctctgggactacagcgccgagttcggggacgagctgtccttccgc
gagggcgagtcggtcaccgtgctgcggagggacgggccggaggagaccgactggtggtgg
gccgcgctgcacggccaggagggctacgtgccgcggaactacttcgggctgttccccagg
gtgaagcctcaaaggagtaaagtctag

DBGET integrated database retrieval system