KEGG   Homo sapiens (human): 10850Help
Entry
10850             CDS       T01001                                 

Gene name
CCL27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Definition
chemokine (C-C motif) ligand 27
Orthology
K16598  
C-C motif chemokine 27
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10850 (CCL27)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10850 (CCL27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 112 aa AA seqDB search
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcccccaaccttctgcagcctcctgctgctgtcattgctcctgagcccagac
cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaag
ccactctcagacaagctactgaggaaggtcatccaggtggaactgcaggaggctgacggg
gactgtcacctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc
cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccatgggactctg
cccaagctgaattttgggatgctaaggaaaatgggctga

DBGET integrated database retrieval system