KEGG   Homo sapiens (human): 10865Help
Entry
10865             CDS       T01001                                 

Gene name
ARID5A, MRF-1, MRF1, RP11-363D14
Definition
(RefSeq) AT-rich interaction domain 5A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q11.2
AA seq 594 aa AA seqDB search
MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQA
FLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGG
SPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPK
KAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYK
RLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQS
PKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPR
DFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAG
SGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLA
TAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctgtcaaagggaacaggaagcagtccacggagggtgacgccctagaccca
cctgcatcccccaaacctgctggcaagcagaacggaatccagaaccccatctcgctggag
gactcccccgaggcaggcggggagcgggaggaggagcaggagcgggaggaggagcaggcc
ttcctggtcagcctctacaagttcatgaaggagcgacacacgcccatcgagagggtgccc
catctcggcttcaagcagattaacctgtggaagatctacaaagcagtggagaagctgggg
gcctatgagctggtgaccgggcgccgcctctggaagaacgtgtacgacgagctggggggc
agcccaggcagcaccagcgcggccacgtgcacgcgccgccactacgagaggctggtcctg
ccatacgtgcggcacctgaagggggaggatgacaagccgctgcccacctccaagcccagg
aaacagtacaagatggctaaggagaacaggggggatgatggggccaccgagaggccgaag
aaggccaaggaggagcggcgcatggaccagatgatgccaggaaagaccaaagcagatgct
gctgacccagcaccacttcccagccaggagccccccaggaacagcacagaacagcagggc
ctggcctctgggtcttctgtgtcctttgtgggtgccagcggctgtcctgaggcctacaag
cggctcctatccagcttctactgcaaggggacacacggcatcatgtcaccactggccaaa
aagaagctcctggcccaggtgagcaaggtggaggccttgcagtgccaggaggagggctgc
cgccatggggcagagccccaggcgtccccagctgttcacctcccagagagtccccagagc
cccaaagggctgactgagaactccaggcaccggctgacccctcaggagggattgcaggcc
ccaggtggcagcctcagagaggaggcgcaggcaggcccctgcccggcagcccccatcttc
aagggctgcttctacacccaccccaccgaggtgctgaagcctgtcagccagcaccccagg
gacttcttctctagacttaaagatggggtgctattggggcctcctggcaaagaggggctg
tcagtgaaagagccccagctggtgtggggcggagacgctaaccgcccttctgcgttccat
aaaggtggctccagaaagggcatcctctaccccaagcccaaagcctgctgggtgtccccc
atggccaaggtcccagccgagagccccacgctcccgcccaccttccccagtagcccaggc
ctgggcagcaagcgcagcctggaggaagagggtgctgcccacagtgggaagagactgcgg
gccgtgtctccctttcttaaggaggcggatgccaagaagtgtggggccaaacctgcaggg
tccggcctggtctcctgccttctgggcccagccctggggcctgtgcccccagaggcctac
aggggcaccatgctgcactgcccgctgaacttcactggcaccccgggccccttgaagggc
caggctgcactccccttcagccccctggtcatcccggccttcccggcccacttcctggcc
accgcaggcccctcgcccatggccgctggcctgatgcacttccccccaacgtccttcgac
agtgccctccgccacagactttgcccggcctcatctgcctggcacgcaccaccagtcaca
acctatgcagcgccccacttcttccacctcaacaccaagctgtag

DBGET integrated database retrieval system