KEGG   Homo sapiens (human): 10865Help
Entry
10865             CDS       T01001                                 

Gene name
ARID5A, MRF-1, MRF1, RP11-363D14
Definition
(RefSeq) AT-rich interaction domain 5A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ARID
Motif
Other DBs
NCBI-GeneID: 10865
NCBI-ProteinID: NP_997646
OMIM: 611583
HGNC: 17361
Ensembl: ENSG00000196843
Vega: OTTHUMG00000155229
Pharos: Q03989(Tdark)
UniProt: Q03989
Position
2q11.2
AA seq 594 aa AA seqDB search
MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQA
FLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGG
SPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPK
KAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYK
RLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQS
PKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPR
DFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAG
SGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLA
TAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccctgtcaaagggaacaggaagcagtccacggagggtgacgccctagaccca
cctgcatcccccaaacctgctggcaagcagaacggaatccagaaccccatctcgctggag
gactcccccgaggcaggcggggagcgggaggaggagcaggagcgggaggaggagcaggcc
ttcctggtcagcctctacaagttcatgaaggagcgacacacgcccatcgagagggtgccc
catctcggcttcaagcagattaacctgtggaagatctacaaagcagtggagaagctgggg
gcctatgagctggtgaccgggcgccgcctctggaagaacgtgtacgacgagctggggggc
agcccaggcagcaccagcgcggccacgtgcacgcgccgccactacgagaggctggtcctg
ccatacgtgcggcacctgaagggggaggatgacaagccgctgcccacctccaagcccagg
aaacagtacaagatggctaaggagaacaggggggatgatggggccaccgagaggccgaag
aaggccaaggaggagcggcgcatggaccagatgatgccaggaaagaccaaagcagatgct
gctgacccagcaccacttcccagccaggagccccccaggaacagcacagaacagcagggc
ctggcctctgggtcttctgtgtcctttgtgggtgccagcggctgtcctgaggcctacaag
cggctcctatccagcttctactgcaaggggacacacggcatcatgtcaccactggccaaa
aagaagctcctggcccaggtgagcaaggtggaggccttgcagtgccaggaggagggctgc
cgccatggggcagagccccaggcgtccccagctgttcacctcccagagagtccccagagc
cccaaagggctgactgagaactccaggcaccggctgacccctcaggagggattgcaggcc
ccaggtggcagcctcagagaggaggcgcaggcaggcccctgcccggcagcccccatcttc
aagggctgcttctacacccaccccaccgaggtgctgaagcctgtcagccagcaccccagg
gacttcttctctagacttaaagatggggtgctattggggcctcctggcaaagaggggctg
tcagtgaaagagccccagctggtgtggggcggagacgctaaccgcccttctgcgttccat
aaaggtggctccagaaagggcatcctctaccccaagcccaaagcctgctgggtgtccccc
atggccaaggtcccagccgagagccccacgctcccgcccaccttccccagtagcccaggc
ctgggcagcaagcgcagcctggaggaagagggtgctgcccacagtgggaagagactgcgg
gccgtgtctccctttcttaaggaggcggatgccaagaagtgtggggccaaacctgcaggg
tccggcctggtctcctgccttctgggcccagccctggggcctgtgcccccagaggcctac
aggggcaccatgctgcactgcccgctgaacttcactggcaccccgggccccttgaagggc
caggctgcactccccttcagccccctggtcatcccggccttcccggcccacttcctggcc
accgcaggcccctcgcccatggccgctggcctgatgcacttccccccaacgtccttcgac
agtgccctccgccacagactttgcccggcctcatctgcctggcacgcaccaccagtcaca
acctatgcagcgccccacttcttccacctcaacaccaagctgtag

DBGET integrated database retrieval system