KEGG   Homo sapiens (human): 10885Help
Entry
10885             CDS       T01001                                 

Gene name
WDR3, DIP2, UTP12
Definition
(RefSeq) WD repeat domain 3
  KO
K14556  U3 small nucleolar RNA-associated protein 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    10885 (WDR3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    10885 (WDR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Utp12 ANAPC4_WD40 WD40_like Utp21 Coatomer_WDAD YbaB_DNA_bd
Motif
Other DBs
NCBI-GeneID: 10885
NCBI-ProteinID: NP_006775
OMIM: 604737
HGNC: 12755
Ensembl: ENSG00000065183
Vega: OTTHUMG00000012197
Pharos: Q9UNX4(Tbio)
UniProt: Q9UNX4 Q5TDG3
Position
1p12
AA seq 943 aa AA seqDB search
MGLTKQYLRYVASAVFGVIGSQKGNIVFVTLRGEKGRYVAVPACEHVFIWDLRKGEKILI
LQGLKQEVTCLCPSPDGLHLAVGYEDGSIRIFSLLSGEGNVTFNGHKAAITTLKYDQLGG
RLASGSKDTDIIVWDVINESGLYRLKGHKDAITQALFLREKNLLVTSGKDTMVKWWDLDT
QHCFKTMVGHRTEVWGLVLLSEEKRLITGASDSELRVWDIAYLQEIEDPEEPDPKKIKGS
SPGIQDTLEAEDGAFETDEAPEDRILSCRKAGSIMREGRDRVVNLAVDKTGRILACHGTD
SVLELFCILSKKEIQKKMDKKMKKARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIK
TSAKIKSFDLIHSPHGELKAVFLLQNNLVELYSLNPSLPTPQPVRTSRITIGGHRSDVRT
LSFSSDNIAVLSAAADSIKIWNRSTLQCIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQL
YDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSV
KQTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDIS
HDGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQW
DADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREPLILEEEREMERE
AEYEESVAKEDQPAVPGETQGDSYFTGKKTIETVKAAERIMEAIELYREETAKMKEHKAI
CKAAGKEVPLPSNPILMAYGSISPSAYVLEIFKGIKSSELEESLLVLPFSYVPDILKLFN
EFIQLGSDVELICRCLFFLLRIHFGQITSNQMLVPVIEKLRETTISKVSQVRDVIGFNMA
GLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atggggctcaccaagcagtacctacgctatgttgctagtgcggtctttggcgttatcggc
agccaaaaaggtaatattgtctttgtgacacttcgtggtgagaaaggacgttatgtggca
gtaccagcttgtgaacacgttttcatctgggacttaaggaaaggagagaagattcttatc
cttcaggggcttaaacaagaagttacttgcttatgcccctccccagatgggctacactta
gctgttgggtatgaggatgggtcgatccgaatcttcagtctcctgagtggggaaggaaat
gtgaccttcaatggtcacaaagcagctatcactaccttgaagtatgatcagctaggaggc
agactggcatctgggtccaaggacacagatattattgtatgggatgtgatcaatgaaagt
ggtctgtaccgtctaaaggggcacaaggatgccatcacacaagcattgtttctacgagaa
aagaacctgctagttactagtgggaaagataccatggtgaaatggtgggaccttgatact
cagcactgctttaaaacaatggttggccaccggactgaggtatgggggttggttctgttg
tcagaagaaaagcgactcatcactggggcctcagacagtgaactgagggtatgggacata
gcttatctgcaagagattgaagacccggaagaaccagaccccaagaaaatcaaaggatct
tctcctggaatacaagatactcttgaggcagaggatggtgcctttgagacggatgaagcc
cctgaggatcgaatcctttcatgcagaaaagctggttccataatgcgggaaggaagagac
agagttgtaaaccttgcagtcgacaagacaggcaggattcttgcttgccatggaactgac
tctgtgctagaattgttttgtatcctttccaaaaaggaaattcagaagaaaatggataag
aagatgaagaaagctagaaagaaagcaaaattacattctagcaaaggagaggaggaagat
cctgaggttaatgttgaaatgagtctgcaagatgaaatccagcgggtgactaatataaaa
acttctgccaaaatcaagtcctttgacttgattcattcacctcacggagagttaaaggct
gtcttcctgctgcagaacaacctggtggaattgtattcactgaatccatccttgcctact
cctcagcctgtcaggacaagcagaatcactattgggggtcatcgcagtgatgtgcggact
ttgtcattcagctcagacaatattgctgttctttcagctgcagctgattccattaaaata
tggaacaggtctacactgcagtgtattcgcacaatgacctgtgaatatgcactttgctca
ttctttgtacctggtgatagacaggtagtcataggaacaaagacagggaagctgcagctt
tatgacttggcttcagggaatctgctggagacaatagatgcacatgatggagctttgtgg
tccatgtccctctctccagatcagcgtggctttgtgacaggtggtgcagataaatctgtc
aaattctgggattttgagttagtgaaagatgaaaatagtacccaaaagagactttctgtg
aagcaaacccgaactttgcaactagatgaagatgttctgtgtgtcagttactctcccaat
caaaagctattggctgtgtctttgctggactgtactgtgaaaattttctacgttgatact
ttaaagttttttctgtcactgtatggacacaaactgcctgttatatgcatggacatctct
catgatggagcactcatagcaactggctccgctgataggaatgtgaaaatctggggtttg
gactttggggactgccacaagtctctctttgcacatgatgacagtgtgatgtacctacag
tttgtacccaagtctcacctcttcttcactgccggaaaagatcataagattaaacagtgg
gatgcagacaaatttgaacacatacagactctggagggtcatcaccaggaaatatggtgt
ttggctgtaagccccagtggagactatgttgtatcatcgtcccatgacaaatctctgaga
ctttgggagagaacaagggagcctcttattcttgaggaagaaagggagatggaaagagaa
gcagaatatgaggagagtgtggccaaagaagaccaaccagcagttccaggagagactcaa
ggtgacagttactttactggaaagaaaactattgaaacagtgaaagcagctgagaggatt
atggaggctattgagttgtaccgagaagaaactgcaaaaatgaaggaacacaaagccatt
tgtaaagctgcagggaaagaggttccacttcccagcaaccccatcctaatggcttatggc
agtatctcaccttcagcttatgtattagagatttttaaagggatcaagtcgagtgagctg
gaagaatctctacttgtgctgcctttctcttatgtcccagacattcttaaactctttaac
gaattcattcagctgggctctgatgttgaacttatatgccggtgcctcttcttcctcctt
aggattcactttggacagatcactagcaatcaaatgcttgtgccagtgatagaaaaatta
agggaaacaactatttcaaaagtcagccaagtccgggatgttatcggcttcaatatggct
ggtcttgattatctcaagagggaatgcgaggcaaaaagtgaagttatgttttttgctgat
gctactagccacttggaagagaagaagaggaagaggaaaaagagggagaagttgattcta
acgttgacttag

DBGET integrated database retrieval system