KEGG   Homo sapiens (human): 10886Help
Entry
10886             CDS       T01001                                 

Gene name
NPFFR2, GPR74, HLWAR77, NPFF2, NPGPR
Definition
(RefSeq) neuropeptide FF receptor 2
  KO
K08375  
neuropeptide FF receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10886 (NPFFR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide FF
    10886 (NPFFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y5X5(Tchem)
UniProt: 
Position
4q13.3
AA seq 522 aa AA seqDB search
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR
LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN
VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT
VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA
IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN
KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN
QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ
LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcttcttcggaaccccagcggccagctggtgcctcctggaaagtgacgtctca
tctgcaccggacaaggaggcggggagggagcgcagagcactcagcgtccagcagcgcggc
gggccagcctggagcggaagcctggagtggagcaggcagtccgcgggggacagacgtcgg
ctgggattgagccggcagactgcgaaaagtagctggagccggagcagggacagaacctgt
tgctgcagacgggcttggtggattctggttcctgccgccgacagggctcgccgggagagg
ttcatcatgaatgagaaatgggacacaaactcttcagaaaactggcatcccatctggaat
gtcaatgacacaaagcatcatctgtactcagatattaatattacctatgtgaactactat
cttcaccagcctcaagtggcagcaatcttcattatttcctactttctgatcttctttttg
tgcatgatgggaaatactgtggtttgctttattgtaatgaggaacaaacatatgcacaca
gtcactaatctcttcatcttaaacctggccataagtgatttactagttggcatattctgc
atgcctataacactgctggacaatattatagcaggatggccatttggaaacacgatgtgc
aagatcagtggattggtccagggaatatctgtcgcagcttcagtctttacgttagttgca
attgctgtagataggttccagtgtgtggtctacccttttaaaccaaagctcactatcaag
acagcgtttgtcattattatgatcatctgggtcctagccatcaccattatgtctccatct
gcagtaatgttacatgtgcaagaagaaaaatattaccgagtgagactcaactcccagaat
aaaaccagtccagtctactggtgccgggaagactggccaaatcaggaaatgaggaagatc
tacaccactgtgctgtttgccaacatctacctggctcccctctccctcattgtcatcatg
tatggaaggattggaatttcactcttcagggctgcagttcctcacacaggcaggaagaac
caggagcagtggcacgtggtgtccaggaagaagcagaagatcattaagatgctcctgatt
gtggccctgctttttattctctcatggctgcccctgtggactctaatgatgctctcagac
tacgctgacctttctccaaatgaactgcagatcatcaacatctacatctacccttttgca
cactggctggcattcggcaacagcagtgtcaatcccatcatttatggtttcttcaacgag
aatttccgccgtggtttccaagaagctttccagctccagctctgccaaaaaagagcaaag
cctatggaagcttatgccctaaaagctaaaagccatgtgctcataaacacatctaatcag
cttgtccaggaatctacatttcaaaaccctcatggggaaaccttgctttataggaaaagt
gctgaaaaaccccaacaggaattagtgatggaagaattaaaagaaactactaacagcagt
gagatttaa

DBGET integrated database retrieval system