KEGG   Homo sapiens (human): 10887Help
Entry
10887             CDS       T01001                                 

Gene name
PROKR1, GPR73, GPR73a, PKR1, ZAQ
Definition
(RefSeq) prokineticin receptor 1
  KO
K08379  
prokineticin receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Gut peptide
   Prokineticin
    10887 (PROKR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 393 aa AA seqDB search
METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFA
AKIVIGMALVGIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEM
DYYVVRQLSWEHGHVLCTSVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAT
GLIALVWTVSILIAIPSAYFTTETVLVIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGIE
FVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPF
YGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTVKYFKKIMLLH
WKASYNGGKSSADLDLKTIGMPATEEVDCIRLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccatggggttcatggatgacaatgccaccaacacttccaccagcttcctt
tctgtgctcaaccctcatggagcccatgccacttccttcccattcaacttcagctacagc
gactatgatatgcctttggatgaagatgaggatgtgaccaattccaggacgttctttgct
gccaagattgtcattgggatggccctggtgggcatcatgctggtctgcggcattggaaac
ttcatctttatcgctgccctggtccgctacaagaaactgcgcaacctcaccaacctgctc
atcgccaacctggccatctctgacttcctggtggccattgtctgctgcccctttgagatg
gactactatgtggtgcgccagctctcctgggagcacggccacgtcctgtgcacctctgtc
aactacctgcgcactgtctctctctatgtctccaccaatgccctgctggccatcgccatt
gacaggtatctggctattgtccatccgctgagaccacggatgaagtgccaaacagccact
ggcctgattgccttggtgtggacggtgtccatcctgatcgccatcccttccgcctacttc
accaccgagacggtcctcgtcattgtcaagagccaggaaaagatcttctgcggccagatc
tggcctgtggaccagcagctctactacaagtcctacttcctctttatctttggcatagaa
ttcgtgggccccgtggtcaccatgaccctgtgctatgccaggatctcccgggagctctgg
ttcaaggcggtccctggattccagacagagcagatccgcaagaggctgcgctgccgcagg
aagacggtcctggtgctcatgtgcatcctcaccgcctacgtgctatgctgggcgcccttc
tacggcttcaccatcgtgcgcgacttcttccccaccgtgtttgtgaaggagaagcactac
ctcactgccttctacatcgtcgagtgcatcgccatgagcaacagcatgatcaacactctg
tgcttcgtgaccgtcaagaacgacaccgtcaagtacttcaaaaagatcatgttgctccac
tggaaggcttcttacaatggcggtaagtccagtgcagacctggacctcaagacaattggg
atgcctgccaccgaagaggtggactgcatcagactaaaataa

DBGET integrated database retrieval system