KEGG   Homo sapiens (human): 10892Help
Entry
10892             CDS       T01001                                 

Gene name
MALT1, IMD12, MLT, MLT1
Definition
mucosa associated lymphoid tissue lymphoma translocation gene 1 (EC:3.4.22.-)
Orthology
K07369  
mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Tuberculosis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21
AA seq 824 aa AA seqDB search
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgttgggggacccgctacaggccctgccgccctcggccgcccccacggggccg
ctgctcgcccctccggccggcgcgaccctcaaccgcctgcgggagccgctgctgcggagg
ctcagcgagctcctggatcaggcgcccgagggccggggctggaggagactggcggagctg
gcggggagtcgcgggcgcctccgcctcagttgcctagacctggagcagtgttctcttaag
gtactggagcctgaaggaagccccagcctgtgtctgctgaagttaatgggtgaaaaaggt
tgcacagtcacagaattgagtgatttcctgcaggctatggaacacactgaagttcttcag
cttctcagccccccaggaataaagattactgtaaacccagagtcaaaggcagtcttggct
ggacagtttgtgaaactgtgttgccgggcaactggacatccttttgttcaatatcagtgg
ttcaaaatgaataaagagattccaaatggaaatacatcagagcttatttttaatgcagtg
catgtaaaagatgcaggcttttatgtctgtcgagttaataacaatttcacctttgaattc
agccagtggtcacagctggatgtttgcgacatcccagagagcttccagagaagtgttgat
ggcgtctctgaatccaagttgcaaatctgtgttgaaccaacttcccaaaagctgatgcca
ggcagcacattggttttacagtgtgttgctgttggaagccctattcctcactaccagtgg
ttcaaaaatgaattaccattaacacatgagaccaaaaagctatacatggtgccttatgtg
gatttggaacaccaaggaacctactggtgtcatgtatataatgatcgagacagtcaagat
agcaagaaggtagaaatcatcataggaagaacagatgaggcagtggagtgcactgaagat
gaattaaataatcttggtcatcctgataataaagagcaaacaactgaccagcctttggcg
aaggacaaggttgcccttttgataggaaatatgaattaccgggagcaccccaagctcaaa
gctcctttggtggatgtgtacgaattgactaacttactgagacagctggacttcaaagtg
gtttcactgttggatcttactgaatatgagatgcgtaatgctgtggatgagtttttactc
cttttagacaagggagtatatgggttattatattatgcaggacatggttatgaaaatttt
gggaacagcttcatggtccccgttgatgctccaaatccatataggtctgaaaattgtctg
tgtgtacaaaatatactgaaattgatgcaagaaaaagaaactggacttaatgtgttctta
ttggatatgtgtaggaaaagaaatgactacgatgataccattccaatcttggatgcacta
aaagtcaccgccaatattgtgtttggatatgccacgtgtcaaggagcagaagcttttgaa
atccagcattctggattggcaaatggaatctttatgaaatttttaaaagacagattatta
gaagataagaaaatcactgtgttactggatgaagttgcagaagatatgggtaagtgtcac
cttaccaaaggcaaacaggctctagagattcgaagtagtttatctgagaagagagcactt
actgatccaatacagggaacagaatattctgctgaatctcttgtgcggaatctacagtgg
gccaaggctcatgaacttccagaaagtatgtgtcttaagtttgactgtggtgttcagatt
caattaggatttgcagctgagttttccaatgtcatgatcatctatacaagtatagtttac
aaaccaccggagataataatgtgtgatgcctacgttactgattttccacttgatctagat
attgatccaaaagatgcaaataaaggcacacctgaagaaactggcagctacttggtatca
aaggatcttcccaagcattgcctctataccagactcagttcactgcaaaaattaaaggaa
catctagtcttcacagtatgtttatcatatcagtactcaggattggaagatactgtagag
gacaagcaggaagtgaatgttgggaaacctctcattgctaaattagacatgcatcgaggt
ttgggaaggaagacttgctttcaaacttgtcttatgtctaatggtccttaccagagttct
gcagccacctcaggaggagcagggcattatcactcattgcaagacccattccatggtgtt
taccattcacatcctggtaatccaagtaatgttacaccagcagatagctgtcattgcagc
cggactccagatgcatttatttcaagtttcgctcaccatgcttcatgtcattttagtaga
agtaatgtgccagtagagacaactgatgaaataccatttagtttctctgacaggctcaga
atttctgaaaaatga

DBGET integrated database retrieval system