KEGG   Homo sapiens (human): 10894Help
Entry
10894             CDS       T01001                                 

Gene name
LYVE1, CRSBP-1, HAR, LYVE-1, XLKD1
Definition
(RefSeq) lymphatic vessel endothelial hyaluronan receptor 1
  KO
K19012  
lymphatic vessel endothelial hyaluronan receptor 1
Organism
hsa  Homo sapiens (human)
Brite
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   10894 (LYVE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11p15
AA seq 322 aa AA seqDB search
MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEA
CRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPV
SRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPA
PTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPTAL
LVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIETKVVKEEKANDSNPNEESKKT
DKNPEESKSPSKTTVRCLEAEV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggccaggtgcttcagcctggtgttgcttctcacttccatctggaccacgaggctcctg
gtccaaggctctttgcgtgcagaagagctttccatccaggtgtcatgcagaattatgggg
atcacccttgtgagcaaaaaggcgaaccagcagctgaatttcacagaagctaaggaggcc
tgtaggctgctgggactaagtttggccggcaaggaccaagttgaaacagccttgaaagct
agctttgaaacttgcagctatggctgggttggagatggattcgtggtcatctctaggatt
agcccaaaccccaagtgtgggaaaaatggggtgggtgtcctgatttggaaggttccagtg
agccgacagtttgcagcctattgttacaactcatctgatacttggactaactcgtgcatt
ccagaaattatcaccaccaaagatcccatattcaacactcaaactgcaacacaaacaaca
gaatttattgtcagtgacagtacctactcggtggcatccccttactctacaatacctgcc
cctactactactcctcctgctccagcttccacttctattccacggagaaaaaaattgatt
tgtgtcacagaagtttttatggaaactagcaccatgtctacagaaactgaaccatttgtt
gaaaataaagcagcattcaagaatgaagctgctgggtttggaggtgtccccacggctctg
ctagtgcttgctctcctcttctttggtgctgcagctggtcttggattttgctatgtcaaa
aggtatgtgaaggccttcccttttacaaacaagaatcagcagaaggaaatgatcgaaacc
aaagtagtaaaggaggagaaggccaatgatagcaaccctaatgaggaatcaaagaaaact
gataaaaacccagaagagtccaagagtccaagcaaaactaccgtgcgatgcctggaagct
gaagtttag

DBGET integrated database retrieval system