KEGG   Homo sapiens (human): 10898Help
Entry
10898             CDS       T01001                                 

Gene name
CPSF4, CPSF30, NAR, NEB1
Definition
cleavage and polyadenylation specific factor 4, 30kDa
Orthology
K14404  
cleavage and polyadenylation specificity factor subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    10898 (CPSF4)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    10898 (CPSF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     10898 (CPSF4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     10898 (CPSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 244 aa AA seqDB search
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAF
LSGQ
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatcatcgccagcgtggaccacatcaagtttgacttggagatcgcggtggag
cagcagctgggggcgcagccgctgcccttccccggcatggacaagtcgggcgctgctgtc
tgtgaattctttttgaaagctgcctgcggcaaagggggcatgtgtccgtttcgccacatc
agtggtgagaagacagttgtgtgcaaacactggctgcgtggcctatgcaagaaaggggac
cagtgtgagttcctgcatgagtatgacatgaccaagatgcccgagtgctacttctactcc
aagttcggggagtgcagcaacaaggaatgtcccttcctgcacatcgaccccgagtccaag
atcaaggactgtccttggtatgaccgtggcttctgcaagcacggtcccctctgcaggcac
cggcacacacggagagtcatctgtgtgaattacctcgtgggattctgcccggaggggccc
tcgtgtaaattcatgcaccctcgatttgaactgcccatgggaaccaccgagcagccccca
ctgccgcagcagacacagcctccagcaaagcagagaaccccgcaggtcatcggggtcatg
cagagtcaaaacagcagcgcgggcaaccggggaccccggccactggagcaggtcacctgt
tacaagtgtggcgagaaaggacactacgccaacagatgcaccaaagggcacttggccttt
ctcagtggacagtga

DBGET integrated database retrieval system