KEGG   Homo sapiens (human): 10898Help
Entry
10898             CDS       T01001                                 

Gene name
CPSF4, CPSF30, NAR, NEB-1, NEB1
Definition
(RefSeq) cleavage and polyadenylation specific factor 4
  KO
K14404  cleavage and polyadenylation specificity factor subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    10898 (CPSF4)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    10898 (CPSF4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     10898 (CPSF4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     10898 (CPSF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf-CCCH_3 Torus zf-CCHC zf-CCCH_2 zf-C3H1
Motif
Other DBs
NCBI-GeneID: 10898
NCBI-ProteinID: NP_006684
OMIM: 603052
HGNC: 2327
Ensembl: ENSG00000160917
Vega: OTTHUMG00000154599
Pharos: O95639(Tbio)
UniProt: O95639
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 269 aa AA seqDB search
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatcatcgccagcgtggaccacatcaagtttgacttggagatcgcggtggag
cagcagctgggggcgcagccgctgcccttccccggcatggacaagtcgggcgctgctgtc
tgtgaattctttttgaaagctgcctgcggcaaagggggcatgtgtccgtttcgccacatc
agtggtgagaagacagttgtgtgcaaacactggctgcgtggcctatgcaagaaaggggac
cagtgtgagttcctgcatgagtatgacatgaccaagatgcccgagtgctacttctactcc
aagttcggggagtgcagcaacaaggaatgtcccttcctgcacatcgaccccgagtccaag
atcaaggactgtccttggtatgaccgtggcttctgcaagcacggtcccctctgcaggcac
cggcacacacggagagtcatctgtgtgaattacctcgtgggattctgcccggaggggccc
tcgtgtaaattcatgcaccctcgatttgaactgcccatgggaaccaccgagcagccccca
ctgccgcagcagacacagcctccagcaaagcaaagtaacaatccgccattacaaaggtcg
tcctccttgatccagttaacgagtcagaactcttctcccaatcagcagagaaccccgcag
gtcatcggggtcatgcagagtcaaaacagcagcgcgggcaaccggggaccccggccactg
gagcaggtcacctgttacaagtgtggcgagaaaggacactacgccaacagatgcaccaaa
gggcacttggcctttctcagtggacagtga

DBGET integrated database retrieval system