KEGG   Homo sapiens (human): 10907Help
Entry
10907             CDS       T01001                                 

Gene name
TXNL4A, DIB1, DIM1, HsT161, SNRNP15, TXNL4, U5-15kD
Definition
thioredoxin-like 4A
Orthology
K12859  
U5 snRNP protein, DIM1 family
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10907 (TXNL4A)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    10907 (TXNL4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q23
AA seq 142 aa AA seqDB search
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacatgctcccgcacctgcacaacggctggcaggtggaccaggccatcctctcg
gaggaggaccgcgtggtcgtcatccgcttcggccacgactgggatcctacgtgcatgaag
atggacgaggtcctgtacagcatcgccgagaaggttaaaaattttgcagttatttatctt
gtggatattacagaagtgcctgacttcaacaaaatgtatgagttatacgatccatgtact
gtcatgtttttcttcaggaacaagcacatcatgattgacttggggactggcaacaacaac
aagattaactgggccatggaggacaagcaggagatggtggacatcatcgagacggtgtac
cgcggggcccgcaaaggccgcggcctggtggtgtcccccaaggactactccaccaagtac
cgctactga

DBGET integrated database retrieval system