KEGG   Homo sapiens (human): 10910Help
Entry
10910             CDS       T01001                                 

Gene name
SUGT1, SGT1
Definition
SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Orthology
K12795  
suppressor of G2 allele of SKP1
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 365 aa AA seqDB search
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcagcaggaactgcaacatcccagaggtttttccagagcttctcggat
gccctaatcgacgaggacccccaggcggcgttagaggagctgactaaggctttggaacag
aaaccagatgatgcacagtattattgtcaaagagcttattgtcacattcttcttgggaat
tactgtgttgctgttgctgatgcaaagaagtctctagaactcaatccaaataattccact
gctatgctgagaaaaggaatatgtgaataccatgaaaaaaactatgctgctgccctagaa
acttttacagaaggacaaaaattagatatagagacggggtttcatcgtgttggccaggct
ggtctccaactcttgacctcaagtgatccacctgccttggactcccaaagtgctgggatt
acaggtgcagatgctaatttcagtgtctggattaaaaggtgtcaagaagctcagaatggc
tcagaatctgaggtgtggactcatcagtcaaaaatcaagtatgactggtatcaaacagaa
tctcaagtagtcattacacttatgatcaagaatgttcagaagaatgatgtaaatgtggaa
ttttcagaaaaagagttgtctgctttggttaaacttccttctggagaggattacaatttg
aaactggaacttcttcatcctataataccagaacagagcacgtttaaagtactttcaaca
aagattgaaattaaactgaaaaagccagaggctgtgagatgggaaaagctagaggggcaa
ggagatgtgcctacgccaaaacaattcgtagcagatgtaaagaacctatatccatcatca
tctccttatacaagaaattgggataaattggttggtgagatcaaagaagaagaaaagaat
gaaaagttggagggagatgcagctttaaacagattatttcagcagatctattcagatggt
tctgatgaagtgaaacgtgccatgaacaaatcctttatggagtcgggtggtacagttttg
agtaccaactggtctgatgtaggtaaaaggaaagttgaaatcaatcctcctgatgatatg
gaatggaaaaagtactaa

DBGET integrated database retrieval system