KEGG   Homo sapiens (human): 10912Help
Entry
10912             CDS       T01001                                 

Gene name
GADD45G, CR6, DDIT2, GADD45gamma, GRP17
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    10912 (GADD45G)
   04068 FoxO signaling pathway
    10912 (GADD45G)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10912 (GADD45G)
   04210 Apoptosis
    10912 (GADD45G)
   04115 p53 signaling pathway
    10912 (GADD45G)
   04218 Cellular senescence
    10912 (GADD45G)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    10912 (GADD45G)
   05210 Colorectal cancer
    10912 (GADD45G)
   05212 Pancreatic cancer
    10912 (GADD45G)
   05214 Glioma
    10912 (GADD45G)
   05216 Thyroid cancer
    10912 (GADD45G)
   05220 Chronic myeloid leukemia
    10912 (GADD45G)
   05217 Basal cell carcinoma
    10912 (GADD45G)
   05218 Melanoma
    10912 (GADD45G)
   05213 Endometrial cancer
    10912 (GADD45G)
   05224 Breast cancer
    10912 (GADD45G)
   05222 Small cell lung cancer
    10912 (GADD45G)
   05223 Non-small cell lung cancer
    10912 (GADD45G)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     10912 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     10912 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O95257(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.2
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatc
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

KEGG   Homo sapiens (human): 1647Help
Entry
1647              CDS       T01001                                 

Gene name
GADD45A, DDIT1, GADD45
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1647 (GADD45A)
   04068 FoxO signaling pathway
    1647 (GADD45A)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1647 (GADD45A)
   04210 Apoptosis
    1647 (GADD45A)
   04115 p53 signaling pathway
    1647 (GADD45A)
   04218 Cellular senescence
    1647 (GADD45A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1647 (GADD45A)
   05210 Colorectal cancer
    1647 (GADD45A)
   05212 Pancreatic cancer
    1647 (GADD45A)
   05214 Glioma
    1647 (GADD45A)
   05216 Thyroid cancer
    1647 (GADD45A)
   05220 Chronic myeloid leukemia
    1647 (GADD45A)
   05217 Basal cell carcinoma
    1647 (GADD45A)
   05218 Melanoma
    1647 (GADD45A)
   05213 Endometrial cancer
    1647 (GADD45A)
   05224 Breast cancer
    1647 (GADD45A)
   05222 Small cell lung cancer
    1647 (GADD45A)
   05223 Non-small cell lung cancer
    1647 (GADD45A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     1647 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     1647 (GADD45A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P24522(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.3
AA seq 165 aa AA seqDB search
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcacgatcactgtcggggtg
tacgaagcggccaagctgctcaacgtcgaccccgataacgtggtgttgtgcctgctggcg
gcggacgaggacgacgacagagatgtggctctgcagatccacttcaccctgatccaggcg
ttttgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcttggagaccgacgctggccccgcggcgagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacattcatctcaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcaatgggttccagtgatt
aatctccctgaacggtga

KEGG   Homo sapiens (human): 4616Help
Entry
4616              CDS       T01001                                 

Gene name
GADD45B, GADD45BETA, MYD118
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  
growth arrest and DNA-damage-inducible protein
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Apoptosis
Cellular senescence
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    4616 (GADD45B)
   04064 NF-kappa B signaling pathway
    4616 (GADD45B)
   04068 FoxO signaling pathway
    4616 (GADD45B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    4616 (GADD45B)
   04210 Apoptosis
    4616 (GADD45B)
   04115 p53 signaling pathway
    4616 (GADD45B)
   04218 Cellular senescence
    4616 (GADD45B)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    4616 (GADD45B)
   05210 Colorectal cancer
    4616 (GADD45B)
   05212 Pancreatic cancer
    4616 (GADD45B)
   05214 Glioma
    4616 (GADD45B)
   05216 Thyroid cancer
    4616 (GADD45B)
   05220 Chronic myeloid leukemia
    4616 (GADD45B)
   05217 Basal cell carcinoma
    4616 (GADD45B)
   05218 Melanoma
    4616 (GADD45B)
   05213 Endometrial cancer
    4616 (GADD45B)
   05224 Breast cancer
    4616 (GADD45B)
   05222 Small cell lung cancer
    4616 (GADD45B)
   05223 Non-small cell lung cancer
    4616 (GADD45B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     4616 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     4616 (GADD45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75293(Tbio)
UniProt: 
Position
19p13.3
AA seq 160 aa AA seqDB search
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgacc
gccgcggtggaggagcttttggtggccgctcagcgccaggatcgcctcacagtgggggtg
tacgagtcggccaagttgatgaatgtggacccagacagcgtggtcctctgcctcttggcc
attgacgaggaggaggaggatgacatcgccctgcaaatccacttcacgctcatccagtcc
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctcctgggagagccggccgagacccagggcaccaccgaggcccgagacctgcattgtctc
ctggtcacgaaccctcacacggacgcctggaagagccacggcttggtggaggtggccagc
tactgcgaagaaagccggggcaacaaccagtgggtcccctacatctctcttcaggaacgc
tga

DBGET integrated database retrieval system