KEGG   Homo sapiens (human): 10913Help
Entry
10913             CDS       T01001                                 

Gene name
EDAR, DL, ECTD10A, ECTD10B, ED1R, ED3, ED5, EDA-A1R, EDA1R, EDA3, HRM1
Definition
ectodysplasin A receptor
Orthology
K05162  
tumor necrosis factor receptor superfamily member EDAR
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00651  
Ectodermal dysplasia
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q13
AA seq 448 aa AA seqDB search
MAHVGDCTQTPWLPVLVVSLMCSARAEYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSC
GYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGY
YMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSG
QGHLATALIIAMSTIFIMAIAIVLIIMFYILKTKPSAPACCTSHPGKSVEAQVSKDEEKK
EAPDNVVMFSEKDEFEKLTATPAKPTKSENDASSENEQLLSRSVDSDEEPAPDKQGSPEL
CLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRML
SSTYNSEKAVVKTWRHLAESFGLKRDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIER
LDAVESLCADILEWAGVVPPASQPHAAS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgtgggggactgcacgcagacgccctggctccccgtcctggtggtgtctctg
atgtgctcagcccgagcggaatactcaaactgcggtgagaacgagtactacaaccagact
acggggctgtgccaggagtgccccccgtgtgggccgggagaggagccctacctgtcctgt
ggctacggcaccaaagacgaggactacggctgcgtcccctgcccggcggagaagttttcc
aaaggaggctaccagatatgcaggcgtcacaaagactgtgagggcttcttccgggccacc
gtgctgacaccaggggacatggagaatgacgctgagtgtggcccttgcctccctggctac
tacatgctggagaacagaccgaggaacatctatggcatggtctgctactcctgcctcctg
gcaccccccaacaccaaggaatgtgtgggagccacttcaggagcttctgccaacttccct
ggcacctcgggcagcagcaccctgtctcccttccagcacgcccacaaagaactctcaggc
caaggacacctggccactgccctgatcattgcaatgtccaccatcttcatcatggccatc
gccatcgtcctcatcatcatgttctacatcctgaagacaaagccctctgccccagcctgt
tgcaccagccacccggggaagagcgtggaggcccaagtgagcaaggacgaggagaagaaa
gaggccccagacaacgtggtgatgttctccgagaaggatgaatttgagaagctgacagca
actccagcaaagcccaccaagagcgagaacgatgcctcatccgagaatgagcagctgctg
agccggagcgtcgacagtgatgaggagcccgcccctgacaagcagggctccccggagctg
tgcctgctgtcgctggttcacctggccagggagaagtctgccaccagcaacaagtcagcc
gggattcaaagccggaggaaaaagatcctcgatgtgtatgccaacgtgtgtggagtcgtg
gaaggtcttagccccacggagctgccatttgattgcctcgagaagactagccgaatgctc
agctccacgtacaactctgagaaggctgttgtgaaaacgtggcgccacctcgccgagagc
ttcggcctgaagagggatgagattgggggcatgacagacggcatgcaactctttgaccgc
atcagcacggcaggctacagcatccctgagctactcacaaaactggtgcagattgagcgg
ctggatgctgtggagtccttgtgtgcagacatactggagtgggcgggggttgtgccacct
gcctcccagccacatgctgcatcctga

DBGET integrated database retrieval system