KEGG   Homo sapiens (human): 10915Help
Entry
10915             CDS       T01001                                 

Gene name
TCERG1, CA150, TAF2S, Urn1
Definition
transcription elongation regulator 1
Orthology
K12824  
transcription elongation regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10915 (TCERG1)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    10915 (TCERG1)
 Complex B
    10915 (TCERG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q31
AA seq 1077 aa AA seqDB search
MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
AQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPP
VMVPPFRVPLPGMPIPLPGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTA
DGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKE
IKEEPKEEEMTEEEKAAQKAKPVATAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDD
LIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDE
PVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGVSAFSTW
EKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKF
NPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFE
LLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELER
QARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSSDVSWSDT
RRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTSTWKEVK
KIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESD
QHLKDVEKILQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgtggcggggacgggggcgagagtgaacgattcaacccgggggagctcagg
atggcccaacagcaggccttgaggttccgaggtccggctcccccaccaaatgcagtgatg
cgaggcccaccacctctgatgcgacctcctccaccttttggtatgatgcgaggccctcct
ccaccaccacggccgccctttggacgtcctccttttgatcctaatatgccgccaatgcct
cctccaggagggatacctccacctatgggccctccacacctccagagaccacctttcatg
cctcctcccatgagttccatgcctcctcctccgggtatgatgtttccaccaggaatgcct
cctgtgactgctcctggtactccagcactacctcctacggaggagatatgggttgaaaat
aaaactccagatgggaaggtttattattataatgctcggacacgtgaatctgcatggacc
aagccagatggagttaaggttattcagcaatcagaactgacacctatgcttgcagcccag
gcacaggttcaggctcaggcccaggcgcaggctcaggcccaggcgcaggctcaggcccag
gcacaagctcaggcccaggctcaggctcaggcccaggcccaggcccaggcccaggcccag
gcccaagcccaagcccaggcccaggctcaggctcaggcacaagctcaggcccaggcccag
gctcaggtccaggcccaggtccaggcacaagtgcaagcacaagcagttggagcttccacc
cctacgaccagtagcccagcacctgcagtatccacttcaacatcatcatccaccccttcc
tctaccacttctaccacaacaactgctacttcagttgcgcagacagtatcaacacccaca
acacaagatcagaccccaagttctgctgtttcagttgccacgcctacagttagtgtttca
actcctgctcctacagccacacctgtgcaaaccgttccccagccgcaccctcagacgtta
cctcctgctgttcctcattcagtacctcagccaacaacagcaatacctgcttttccacca
gtaatggtacctccgtttcgtgttccccttcctggcatgccaattccacttccaggtgta
ttgccaggaatggcccctcctatcgtacccatgatacatccccaggttgctattgcagct
tcacctgctaccttagctggagcaacagcagtttctgaatggactgaatataaaacagca
gatgggaagacatattattataataatagaacattagaatcaacctgggaaaaaccccaa
gaactaaaggaaaaagaaaagttagaagagaagattaaagagccaattaaagaaccctct
gaagagcctctgccaatggagacggaggaggaggatcctaaagaagagcctataaaggag
ataaaggaggagcccaaagaagaggagatgactgaagaagaaaaggctgcccagaaggca
aagccagttgctactgctcctattcctggtactccatggtgtgtcgtttggactggtgat
gagcgggtcttcttttataatcccaccactcgtctttctatgtgggaccgacctgatgat
ctgattggcagggcagatgttgacaaaattattcaggagccccctcataaaaaaggaatg
gaggaattgaagaaactaaggcacccaactccgacaatgctgtcgatccaaaagtggcaa
ttctctatgagtgcaattaaagaggaacaagaattaatggaagaaattaatgaagatgag
cctgttaaagcaaaaaaacggaagagagacgataataaagacattgactcagagaaagaa
gctgccatggaagctgaaattaaagctgcccgagaaagggccattgtccctctggaggct
cgaatgaagcagttcaaggacatgctgctagagagaggggtgtctgctttttcaacgtgg
gagaaggagttgcacaagatagtttttgatccccggtacttacttctcaatcctaaagag
agaaaacaggtgtttgatcagtatgtaaagaccagggcagaggaagaacgcagggaaaag
aaaaataaaataatgcaagccaaggaagatttcaaaaaaatgatggaagaagcaaaattt
aatccaagagcaacttttagtgaatttgcagccaagcatgctaaagattcaagattcaaa
gcaattgaaaagatgaaagaccgagaagccttgtttaatgagtttgtggccgctgctagg
aagaaagagaaagaagattcgaagaccagaggtgagaagattaaatcggatttctttgaa
ctattatctaatcatcacttggacagtcagtctcgatggagcaaagtaaaagacaaagta
gaaagtgatccacgttacaaagcagtagatagttcatcaatgagagaagaccttttcaaa
cagtacattgaaaaaatagccaagaatttagactcagaaaaagaaaaggagcttgaaagg
caagcccgcattgaggcaagccttcgagaacgagaaagggaggttcaaaaggcccgttca
gaacaaacaaaagaaatagatcgagagagagagcagcacaaacgagaagaagctatccag
aatttcaaagctcttctgtctgacatggtacgttcttcagatgtgtcatggtctgatact
cgtaggaccctccgaaaagatcaccgctgggaatctggatccttattggaaagagaggag
aaagagaagctttttaatgaacacattgaagcacttaccaaaaaaaagagagagcacttt
aggcaacttctggatgaaacttctgcaattaccttaacatccacgtggaaagaagtaaaa
aaaatcattaaggaagatcctcgatgtattaagttctcctccagtgacaggaaaaaacaa
agagaatttgaagaatatatcagagacaaatatatcacagccaaagctgacttcaggacg
cttttgaaagagaccaaatttataacatatagatccaaaaaattaatccaagaatcagat
cagcacctgaaagatgtagaaaaaattttacagaatgacaaacggtatctagtactggac
tgtgtgccagaggagaggcgtaaactgattgtggcatatgttgatgacctggatcgccgg
ggtccacccccacctcccacagcatcggagcccacgagacgatcaacaaaataa

DBGET integrated database retrieval system